KEGG   Sarcophilus harrisii (Tasmanian devil): 100928468Help
Entry
100928468         CDS       T02286                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10 isoform X2
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05034  Alcoholism
shr05165  Human papillomavirus infection
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100928468 (HDAC10)
  Substance dependence
   05034 Alcoholism
    100928468 (HDAC10)
  Infectious diseases
   05165 Human papillomavirus infection
    100928468 (HDAC10)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100928468 (HDAC10)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100928468 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100928468
NCBI-ProteinID: XP_012405839
Ensembl: ENSSHAG00000009493
Position
5
AA seq 698 aa AA seqDB search
MARGPRGRREKAPSALLPAGTGMAKNRPPGPQGTALIYDKDMARVRLLWDDPECAIEVPE
RLTSTYARLCHRGLAQRCVQLPVREATEEDLELVHSPEYVAVVKGTQTMSREQLHTLAQQ
YDAVYFHPSTFPCARMAVGATLQLVDAVVTGAVGNGMALVRPPGHHSQRDAANGFCVFNN
VAIAAEHAKRRHGLQRILIVDWDIHHGQGIQRAFENDPSVLYFSWHRYEHQSFWPRLRES
DYDVVGQGPGRGFTVNVPWNKVGMRNADYVSVFLHVLLPLAIEFDPELVLVSAGYDSGIG
DPEGEMKATPECFAHLTFLLLPLARGRLCAVLEGGYYLQSLAECVCLTLQTLLGDPVPAL
SGEPVPCLSALESIQNVRAAHAPHWASLRHENSGPVLTPSTWQGDAGPSLLGTPSTGTTD
GLKPLLDKVLSCPPRSLCTGIGLAVPDSASGLNLPPALLQEKGVPLREEEEALWARLDSA
LPQDQALAALGKPLALLDEILAGQVRAGIAVSPTVSATTVAALRRTLSCQALRLLCVTLG
DLDVPEDLRDDGRMLLLNLGGKEQPEAAPSPACIRLAGREATEPGAFLLALTSLILPVAY
GFRPELVLVVLGPGCGLRSLDMDLLTRLLQGPAGGRMLLLLQNSELPSVEALAWALVGRP
LPSTLGPFLSASPEQASAVTRLCRQLQQDWPMLQVSVT
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaggtcccagggggcgcagggagaaagcgccatctgctctcctcccagcaggc
acagggatggctaagaacaggcctccgggaccccaggggacagccctgatctacgacaag
gacatggcccgggtccggctgctctgggacgaccccgagtgtgccattgaggtccccgag
cgcctgacatccacgtacgcccggctttgtcatcgaggactggcacagaggtgtgtgcag
ctgccggtccgcgaggccaccgaggaggacctggagctggtgcacagcccagagtatgtg
gctgtggtgaaggggacccagaccatgagcagagagcagctccataccttggcgcagcag
tatgatgccgtctactttcacccgagtacgttcccttgtgcacggatggccgtgggcgcc
accttgcagctggtggacgcggtagtgaccggagctgttggcaatgggatggcgctggtg
aggcctcccgggcaccacagccaacgagacgccgccaatggcttctgcgtgtttaacaat
gtggccattgccgccgagcacgccaagcggagacatgggctgcagaggatcctgattgtt
gactgggatattcaccatggacaggggatccaacgtgcctttgaaaatgaccccagcgtc
ctctatttctcctggcaccgatatgagcaccagagcttctggccccggctccgggaatca
gattacgatgtggtgggtcagggccccggccgcggtttcactgtcaatgtgccctggaat
aaggttgggatgagaaatgccgattacgtgtctgtcttcctccacgtgctgctcccactg
gccattgagtttgaccctgagctcgtgctagtgtcagctggatatgactccggcatcgga
gaccccgagggggagatgaaggccacacccgaatgctttgcccacctgaccttcctgctg
ttgccactggcccggggccggctctgcgcagtgcttgagggtggctattacctgcagtct
ctggccgagtgtgtgtgtctgaccctgcagactttgctgggagaccctgtgccagctctc
tctggggagccggtcccttgtttgagtgcactggagtcaatccagaacgtgagagcagcc
catgccccgcactgggcaagcctcaggcatgaaaactcaggcccagttctgacgcccagc
acatggcaaggggacgcggggccctccctgcttgggaccccatccacagggaccacagat
gggctgaagcccctcttggacaaggtgctcagctgccccccacgttccctgtgcactggc
attggcctggctgtccctgactcggcctctggccttaacctgcctccagctctcctgcag
gagaagggcgtgcctctgcgtgaggaggaggaagccctgtgggccaggctggactcggcc
ctcccgcaggaccaggccctcgctgctctggggaagcccttggctctgctggacgagatc
ctggctgggcaggtcagggcggggatcgctgtgtctcccacagtttcagctaccacagtg
gcggccctccgcaggaccctcagctgccaggccctgaggctgctctgcgtgactctagga
gacctggacgttcctgaggacctgagggatgatggccgaatgctcctgctaaacctcggg
ggaaaggagcagccggaggcagccccgtcccccgcgtgcatccgcctggccgggcgcgag
gccacggaacccggggccttcctcttggccctcaccagcctcatcctcccggtggcctac
ggtttccggccagagctggtgcttgtggtcctgggccccggctgtggcctccgcagcctg
gacatggatctgctcaccaggctgctccaggggcctgcggggggccggatgctgctgctg
ctccagaactctgagctcccgtcggtagaggccctggcctgggccctggtgggccgaccc
ctccccagcaccctgggtcccttcctctcggcctccccggagcaggcctcggccgtcacc
cgtctctgccggcagctacagcaggactggcccatgctgcaggtgtccgtgacctga

DBGET integrated database retrieval system