KEGG   Sarcophilus harrisii (Tasmanian devil): 100928468Help
Entry
100928468         CDS       T02286                                 

Gene name
HDAC10
Definition
histone deacetylase 10
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100928468 (HDAC10)
  Substance dependence
   05034 Alcoholism
    100928468 (HDAC10)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100928468 (HDAC10)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100928468 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 825 aa AA seqDB search
MGAPGSRESPGGAGMHREGAQAPPRTVWGAGNGEGISAGSLEEASAEPSLKGAGAGVPWD
QAKARKMVCGSASGSPWAQRRSMKGDGQAPVGAEEVTEQGQDGTWALPVRGVTCTGMAKN
RPPGPQGTALIYDKDMARVRLLWDDPECAIEVPERLTSTYARLCHRGLAQRCVQLPVREA
TEEDLELVHSPEYVAVVKGTQTMSREQLHTLAQQYDAVYFHPSTFPCARMAVGATLQLVD
AVVTGAVGNGMALVRPPGHHSQRDAANGFCVFNNVAIAAEHAKRRHGLQRILIVDWDIHH
GQGIQRAFENDPSVLYFSWHRYEHQSFWPRLRESDYDVVGQGPGRGFTVNVPWNKVGMRN
ADYVSVFLHVLLPLAIEFDPELVLVSAGYDSGIGDPEGEMKATPECFAHLTFLLLPLARG
RLCAVLEGGYYLQSLAECVCLTLQTLLGDPVPALSGEPVPCLSALESIQNVRAAHAPHWA
SLRHENSGPVLTPSTWQGDAGPSLLGTPSTGTTDGLKPLLDKVLSCPPRSLCTGIGLAVP
DSASGLNLPPALLQEKGVPLREEEEALWARVGASGCAVGSRMLTWGSPALWVSPLCVCAR
LDSALPQDQALAALGKPLALLDEILAGQVRAGIAVSPTVSATTVAALRRTLSCQALRLLC
VTLGDLDVPEDLRDDGRMLLLNLGGKEQPEAAPSPACIRLAGREATEPGAFLLALTSLIL
PVAYGFRPELVLVVLGPGCGLRSLDMDLLTRLLQGPAGGRMLLLLQNSELPSVEALAWAL
VGRPLPSTLGPFLSASPEQASAVTRLCRQLQRHWTTDHRAEPRPS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgggagccccaggctctcgggaaagcccgggtggggcgggaatgcacagggagggtgct
caggccccacctagaacagtctggggggcagggaacggggagggaatctccgccggctcc
ctggaggaggcttccgcggaaccgagccttaaaggagccggggcaggtgtgccctgggac
caggcaaaggctcggaagatggtctgcggctcggccagtgggagcccgtgggcacagcgc
agaagcatgaagggagatgggcaggcacccgtgggtgccgaggaggtcacagagcagggc
caggacgggacctgggcgctgccagttaggggagtgacatgcacagggatggctaagaac
aggcctccgggaccccaggggacagccctgatctacgacaaggacatggcccgggtccgg
ctgctctgggacgaccccgagtgtgccattgaggtccccgagcgcctgacatccacgtac
gcccggctttgtcatcgaggactggcacagaggtgtgtgcagctgccggtccgcgaggcc
accgaggaggacctggagctggtgcacagcccagagtatgtggctgtggtgaaggggacc
cagaccatgagcagagagcagctccataccttggcgcagcagtatgatgccgtctacttt
cacccgagtacgttcccttgtgcacggatggccgtgggcgccaccttgcagctggtggac
gcggtagtgaccggagctgttggcaatgggatggcgctggtgaggcctcccgggcaccac
agccaacgagacgccgccaatggcttctgcgtgtttaacaatgtggccattgccgccgag
cacgccaagcggagacatgggctgcagaggatcctgattgttgactgggatattcaccat
ggacaggggatccaacgtgcctttgaaaatgaccccagcgtcctctatttctcctggcac
cgatatgagcaccagagcttctggccccggctccgggaatcagattacgatgtggtgggt
cagggccccggccgcggtttcactgtcaatgtgccctggaataaggttgggatgagaaat
gccgattacgtgtctgtcttcctccacgtgctgctcccactggccattgagtttgaccct
gagctcgtgctagtgtcagctggatatgactccggcatcggagaccccgagggggagatg
aaggccacacccgaatgctttgcccacctgaccttcctgctgttgccactggcccggggc
cggctctgcgcagtgcttgagggtggctattacctgcagtctctggccgagtgtgtgtgt
ctgaccctgcagactttgctgggagaccctgtgccagctctctctggggagccggtccct
tgtttgagtgcactggagtcaatccagaacgtgagagcagcccatgccccgcactgggca
agcctcaggcatgaaaactcaggcccagttctgacgcccagcacatggcaaggggacgcg
gggccctccctgcttgggaccccatccacagggaccacagatgggctgaagcccctcttg
gacaaggtgctcagctgccccccacgttccctgtgcactggcattggcctggctgtccct
gactcggcctctggccttaacctgcctccagctctcctgcaggagaagggcgtgcctctg
cgtgaggaggaggaagccctgtgggccagggtgggagcgtcgggctgcgcggttgggtct
cgcatgctgacgtgggggagcccggccctgtgggtgagccctctctgcgtttgtgccagg
ctggactcggccctcccgcaggaccaggccctcgctgctctggggaagcccttggctctg
ctggacgagatcctggctgggcaggtcagggcggggatcgctgtgtctcccacagtttca
gctaccacagtggcggccctccgcaggaccctcagctgccaggccctgaggctgctctgc
gtgactctaggagacctggacgttcctgaggacctgagggatgatggccgaatgctcctg
ctaaacctcgggggaaaggagcagccggaggcagccccgtcccccgcgtgcatccgcctg
gccgggcgcgaggccacggaacccggggccttcctcttggccctcaccagcctcatcctc
ccggtggcctacggtttccggccagagctggtgcttgtggtcctgggccccggctgtggc
ctccgcagcctggacatggatctgctcaccaggctgctccaggggcctgcggggggccgg
atgctgctgctgctccagaactctgagctcccgtcggtagaggccctggcctgggccctg
gtgggccgacccctccccagcaccctgggtcccttcctctcggcctccccggagcaggcc
tcggccgtcacccgtctctgccggcagctacaacggcactggaccacggaccaccgagca
gaaccacgcccttcgtag

DBGET integrated database retrieval system