KEGG   Sarcophilus harrisii (Tasmanian devil): 100928480Help
Entry
100928480         CDS       T02286                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04141  Protein processing in endoplasmic reticulum
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04310  Wnt signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04530  Tight junction
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04664  Fc epsilon RI signaling pathway
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04728  Dopaminergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04926  Relaxin signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05132  Salmonella infection
shr05133  Pertussis
shr05142  Chagas disease (American trypanosomiasis)
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05164  Influenza A
shr05167  Kaposi's sarcoma-associated herpesvirus infection
shr05168  Herpes simplex infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05231  Choline metabolism in cancer
shr05418  Fluid shear stress and atherosclerosis
Module
shr_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100928480 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100928480 (MAPK10)
   04010 MAPK signaling pathway
    100928480 (MAPK10)
   04012 ErbB signaling pathway
    100928480 (MAPK10)
   04310 Wnt signaling pathway
    100928480 (MAPK10)
   04668 TNF signaling pathway
    100928480 (MAPK10)
   04068 FoxO signaling pathway
    100928480 (MAPK10)
   04071 Sphingolipid signaling pathway
    100928480 (MAPK10)
   04024 cAMP signaling pathway
    100928480 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100928480 (MAPK10)
   04137 Mitophagy - animal
    100928480 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    100928480 (MAPK10)
   04215 Apoptosis - multiple species
    100928480 (MAPK10)
   04217 Necroptosis
    100928480 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100928480 (MAPK10)
   04530 Tight junction
    100928480 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100928480 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100928480 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100928480 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100928480 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100928480 (MAPK10)
   04659 Th17 cell differentiation
    100928480 (MAPK10)
   04657 IL-17 signaling pathway
    100928480 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100928480 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100928480 (MAPK10)
   04920 Adipocytokine signaling pathway
    100928480 (MAPK10)
   04912 GnRH signaling pathway
    100928480 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100928480 (MAPK10)
   04917 Prolactin signaling pathway
    100928480 (MAPK10)
   04926 Relaxin signaling pathway
    100928480 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    100928480 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100928480 (MAPK10)
   04722 Neurotrophin signaling pathway
    100928480 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100928480 (MAPK10)
  Development
   04380 Osteoclast differentiation
    100928480 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100928480 (MAPK10)
   05231 Choline metabolism in cancer
    100928480 (MAPK10)
   05210 Colorectal cancer
    100928480 (MAPK10)
   05212 Pancreatic cancer
    100928480 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100928480 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100928480 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100928480 (MAPK10)
   04931 Insulin resistance
    100928480 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100928480 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    100928480 (MAPK10)
   05133 Pertussis
    100928480 (MAPK10)
   05152 Tuberculosis
    100928480 (MAPK10)
   05164 Influenza A
    100928480 (MAPK10)
   05161 Hepatitis B
    100928480 (MAPK10)
   05160 Hepatitis C
    100928480 (MAPK10)
   05168 Herpes simplex infection
    100928480 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100928480 (MAPK10)
   05169 Epstein-Barr virus infection
    100928480 (MAPK10)
   05145 Toxoplasmosis
    100928480 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    100928480 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    100928480 (MAPK10)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928480 (MAPK10)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100928480 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100928480
NCBI-ProteinID: XP_012407499
Ensembl: ENSSHAG00000002029
Position
6
AA seq 426 aa AA seqDB search
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSAG
PLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcaaagtagacaaccagttctacagtgtagaagtgggagattcaacattc
acagttctcaaacgctaccagaatctaaagcctattggctctggggctcagggaatcgtt
tgtgctgcatatgatgctgtccttgacagaaatgtggctattaagaagctcagcagacca
tttcagaaccaaacacatgcaaaacgagcttacagggagctggtcctcatgaagtgtgtg
aatcataaaaatattatcagtttattaaatgtcttcacaccacagaaatcactggaagaa
tttcaagatgtttaccttgtgatggaattgatggatgcaaacttgtgtcaggtaattcaa
atggaattggatcatgagcgcatgtcttacctcctataccaaatgttatgtggaatcaag
caccttcattctgctgggatcatccacagggatttaaagcctagtaacattgtggtgaag
tctgactgcacattgaaaattctggactttggactggccaggactgcaggcacaagcttc
atgatgactccatatgtggtgacacgatattacagagcaccagaagtcatcttgggaatg
ggctacaaagagaatgtggatatatggtctgtaggatgcattatgggagaaatggttcgt
cacaaaatcctctttccaggaagggattatattgatcaatggaacaaagtaattgaacaa
ttaggaacaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactacgtg
gagaatcggcccaagtatgcaggtcttactttccccaagctctttccagattccctcttc
cctgctgactccgagcacaataaacttaaagccagccaagccagggaccttttgtcaaag
atgctagtgattgatccagccaaaaggatatcggtggatgatgccttacagcatccatac
atcaacgtctggtatgatcctgcagaagtggaggcgcctcctccacagatatatgataaa
caactggatgaaagagaacataccattgaagaatggaaagaattgatctataaggaagta
atgaattctgaagaaaagactaaaaatggagtagtaaaaggacaaccttctccttcaggt
gcagcagtgaacagcagcgagagcctccctccatcctcttctgtcaacgacatctcctcc
atgtccactgaccagaccctggcatccgacactgacagtagcttggagacctcggcagga
ccacttggttgttgcaggtga

DBGET integrated database retrieval system