KEGG   Sarcophilus harrisii (Tasmanian devil): 100928564Help
Entry
100928564         CDS       T02286                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100928564 (NLK)
   04310 Wnt signaling pathway
    100928564 (NLK)
   04068 FoxO signaling pathway
    100928564 (NLK)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100928564 (NLK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928564 (NLK)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100928564 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 494 aa AA seqDB search
MSLCGTAANAKMMAAYNGGTSAAAAAGHHHHHHHHLXXXXXXXXXXAAAAMLNPGQQQPY
FPSPAPGQAPGPAATAPAQVQAAAAAAVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVW
SVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFE
EIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVN
SNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAE
LLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLS
SQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTS
DFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTV
AQPSEMPPSPLVWE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacggcagccaacgcaaaaatgatggcggcttacaatggtggtaca
tctgcggcggcagcagcaggtcaccaccaccaccatcaccaccacctnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnngcggctgctgccatgttaaaccccgggcaacaacagccatat
ttcccatcaccggcaccaggtcaggcccctggaccagctgccacggccccagctcaggta
caggctgcagcagcagctgcagttaaagcgcaccatcatcagcactcacaccatccacag
cagcaactggacattgagccggacagacctattggatatggagcctttggtgttgtctgg
tcagtaacagatccaagagatggaaagagagtcgccctcaaaaagatgcccaacgtcttc
cagaatctggtctcttgcaaaagggtcttccgagaactgaagatgttgtgtttttttaaa
catgataacgtactctctgcccttgacatactccaacctccacacattgactattttgaa
gaaatatatgttgtcacagaattgatgcagagtgacctacataaaattatcgtctctcct
caaccactcagctcagatcatgtcaaagtttttctttatcagattttacgaggtttgaaa
tatcttcattctgctggcattttacatcgtgacattaagccagggaatctccttgtgaac
agcaactgtgtgcttaagatttgcgattttggattggccagagtggaggaattggatgaa
tcccgtcacatgactcaggaagttgtcactcagtattatcgggcccccgagatcctgatg
ggcagccgccattacagcaatgccatcgacatctggtctgtgggctgcatctttgcagaa
ctactgggacgaagaatattgtttcaggcacagagtcccattcaacagttggatttgatc
accgacttactgggcacaccgtcactggaagcaatgaggacagcttgcgaaggtgcaaag
gcacacatactcaggggtcctcataaacagccatctcttcctgtactatatacactgtct
agccaagcaacacatgaagctgttcatctcctttgcaggatgttggtctttgatccatcc
aaaagaatatccgctaaggacgccttagcccacccctacctagatgaagggcggctgcga
taccacacctgtatgtgtaaatgttgtttttccacctccactggaagagtttacaccagt
gactttgaacctgtcaccaatcccaaatttgatgacacttttgagaagaatctcagttct
gttcggcaggtaaaagaaattattcatcagttcattttggaacagcagaaaggaaaccga
gtgcctctctgcatcaaccctcagtctgctgcttttaagagcttcattagttccactgtt
gcccagccatctgagatgccgccgtctcctctggtctgggagtga

DBGET integrated database retrieval system