KEGG   Sarcophilus harrisii (Tasmanian devil): 100928564Help
Entry
100928564         CDS       T02286                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100928564 (NLK)
   04310 Wnt signaling pathway
    100928564 (NLK)
   04068 FoxO signaling pathway
    100928564 (NLK)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100928564 (NLK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928564 (NLK)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100928564 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 483 aa AA seqDB search
MSLCGTAANAKMMAAYNGGTSAAAAAGHHHHHHHHAAAAMLNPGQQQPYFPSPAPGQAPG
PAATAPAQVQAAAAAAVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRV
ALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQS
DLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFG
LARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQ
SPIQQLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLL
CRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFD
DTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPL
VWE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacggcagccaacgcaaaaatgatggcggcttacaatggtggtaca
tctgcggcggcagcagcaggtcaccaccaccaccatcaccaccacgcggctgctgccatg
ttaaaccccgggcaacaacagccatatttcccatcaccggcaccaggtcaggcccctgga
ccagctgccacggccccagctcaggtacaggctgcagcagcagctgcagttaaagcgcac
catcatcagcactcacaccatccacagcagcaactggacattgagccggacagacctatt
ggatatggagcctttggtgttgtctggtcagtaacagatccaagagatggaaagagagtc
gccctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaaagggtcttccga
gaactgaagatgttgtgtttttttaaacatgataacgtactctctgcccttgacatactc
caacctccacacattgactattttgaagaaatatatgttgtcacagaattgatgcagagt
gacctacataaaattatcgtctctcctcaaccactcagctcagatcatgtcaaagttttt
ctttatcagattttacgaggtttgaaatatcttcattctgctggcattttacatcgtgac
attaagccagggaatctccttgtgaacagcaactgtgtgcttaagatttgcgattttgga
ttggccagagtggaggaattggatgaatcccgtcacatgactcaggaagttgtcactcag
tattatcgggcccccgagatcctgatgggcagccgccattacagcaatgccatcgacatc
tggtctgtgggctgcatctttgcagaactactgggacgaagaatattgtttcaggcacag
agtcccattcaacagttggatttgatcaccgacttactgggcacaccgtcactggaagca
atgaggacagcttgcgaaggtgcaaaggcacacatactcaggggtcctcataaacagcca
tctcttcctgtactatatacactgtctagccaagcaacacatgaagctgttcatctcctt
tgcaggatgttggtctttgatccatccaaaagaatatccgctaaggacgccttagcccac
ccctacctagatgaagggcggctgcgataccacacctgtatgtgtaaatgttgtttttcc
acctccactggaagagtttacaccagtgactttgaacctgtcaccaatcccaaatttgat
gacacttttgagaagaatctcagttctgttcggcaggtaaaagaaattattcatcagttc
attttggaacagcagaaaggaaaccgagtgcctctctgcatcaaccctcagtctgctgct
tttaagagcttcattagttccactgttgcccagccatctgagatgccgccgtctcctctg
gtctgggagtga

DBGET integrated database retrieval system