KEGG   Sarcophilus harrisii (Tasmanian devil): 100928575Help
Entry
100928575         CDS       T02286                                 

Gene name
MLL2
Definition
myeloid/lymphoid or mixed-lineage leukemia 2
Orthology
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100928575 (MLL2)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100928575 (MLL2)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100928575 (MLL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 5047 aa AA seqDB search
MDDPKPSGEDKDSEPAADGPEASEESGPTEPDPPNPPLGDASVHSPGSSKSQDPPQDCSK
GPLRRCAFCNCGEWSLHGQRELRCFKLPPDWPQGSARPPEGPGLGEAVPLNDDLSQIGFP
EGSTPAHLGKPGELCWAHHWCAAWSVGGQGQDGLELHGVDKAIFSGISQRCSHCTRLGAS
IPCRSPGCPRLYHFPCAAASGSFQSMKTLQLLCLEHGEEAEHLEDAHCVVCDGLGELRDL
LFCTSCGQHYHGACLDTALTARKRAGWQCPDCKVCQTCRQPGEDSMMLVCEACDKGYHTF
CLKPAIQSLPPDSWKCKTCRVCRACGACPAELDPNCQWYENYSLCERCQRQQNPQGGRVG
SSETEQSLHVCSKYSQSELGMASVGAPGDFDTACQEQLEGEKEACRKSEEPGPLHCEAKP
LGKGVLQINRGKQGPKMSHYLRSFPHLRLPPLMKRCHWSPCYYLRSHSCHLSYHQQVQNT
VPLKSSFFLPFPDPPPPPLSPATAVAPPSLSPLGEQEELPDAKGDSEPGTPPEVPILDTP
ISPPPEASCFEPEPIAPIDLTPSPASPEELGELNSPIPLEPPPPQCSPLPLAPSPLGFME
KAPKVLDETESQEMETEPECPALEPSGISPPACPTGDLSCPAPSPAPSPAPALDVFSNLV
EDTICLDETEATGPVPEAGQTSGSSGSDPKGSPLLLDPEELAPVTPMEVYGSDGKQAGQS
SPCEDPEEPVAPPVHTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLS
MELGVSTDVSPARDEGSFRLCTDSLPETDDSLLCDSGATGAGGKAEGDKGRRRSSPARSR
IKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSVETLVADIDSSPSKEEEEEDDDTM
QNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLK
GWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQC
GAVSPGFHCEWQNSYTHCGPCASLVTCPACRAPYVEEDLLIQCRHCERWMHAGCESLFTE
EEVEQAADEGFDCASCQPYVVKPVVPIAPPELVPVKVKEPEPQYFRFEGVWLTETGMAVL
RNLSMSPLHKRRQRRGRLGLLGEGGLEGPEPSDPGGPDDKKDGDLEAEELLKSEVGVEHM
ECEIKLEAPASPDGEPGKEETDEGKKRKRKPYRPGIGGFMVRQRKSHARLKKGPAVLVEV
LSGEGQPDEVVTVDPPTEGAVEQSTAEGDEKKKRRGRKKSKLEDMFPAYLQEAFFGKALL
DLSRKALLVAGDGRPGFVPGTLRGKGDPGPDRKESSASQKGDDGPDIADEESRGPEGNSE
TPGPEEGGIKTSPVPSDSEKPGTPGEGMLSSDLDKIPTEELPKMESKDLQQLFKDVLGSE
REQQIGCGTPNLDGSHTPMQQRPFLQGGLPLGNLPTSSPMDSYPGLCQSPFLDNRERGGF
FSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPV
LYANINFPNLKQDYPDWASRCKQIMKLWRKVPATDKAPYLQKAKDNRAAHRINKVQKQAE
SQISKQTKVGDIARKTDRPTLHLRIPPQPGMLGSPPPASAPTVFIGSPPTPAGLSTSSDG
FLKPPAGTVPGPDSPGDLFLKLPPQVPAQVPLQDPFGLAPSYTLESRFPTAPPAYPPYPG
SAVPPAKPQMLGAPPRPGAGQPGEFQSTPPGTPRHQPSTPDPFLKPRCPSLDNLAIPESP
GVGGAKASEQLISPPPFGEPPRKALEVKKEELGAASPGYGPPSLGFGDSPSSGPHLGSLE
LKAPDVFKAPLTPRASQVEPQSPGIGLRPQEPPSAHAVAPSPPSHADLYRPTPSGSYPET
YSQPPLTPRPQPPPPESCCPLPPRSLPSDPFTRVPASPQSQSSSQSPLTPRPLSTEAFCQ
SPVTPCFQSPDPYSRPPSRPQSRDPFAPLHKPPRSQPPEVAFKAGPLAHTPLGVGGFPVA
LPSGHPNEHHTKSSGGQPPSFVRSPGANVFVGNPSAMRFTFPQAVGEPPLKPPASQPSHP
PPHGINSHYGPGPTVGKPQSTNYTTATGSFHPGGSPLGPGTGPPGEGYGLSPMRPPSVLP
QPAPDGPLAYLPHGASQRGSITSPIDKREDPVSGMATSLVGPELQGPQDPSMANLSQTEL
EKQRQRQRLRELLIRQQIQRNTLRQEKETAAATSAVGPGNWGTESSNPAFEQLNRGPTSY
PGTQDKSGLTGLPPNKLSGSMLGPSPFPAEERLSRPPPPPTPSSIDMNGRQLVGGTQAFF
PRGPFPGPLPQQQQQQLWQQQQQQQATVASMRLSMPARFPQPPGPELGRTILGPPLSGLS
NRLPGPGEPLPGPAGPAQFIELRHNVQKGPGPGSAPYHLQGPPQRPRFFPVAEDSHRLAP
ESLRPLAVPALPPQKPSAPPPPELSNSLHSLPHAKGPSLPAGLELVGRSPSSTETARPPL
VLESAKLPCEDPELDDDFDAHKALEDDEELAHLGIGVDVAKGDDELGTLGNLETNDPHLD
DLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGTEPGLSGLEER
PAPTTDGPDSHLMPGASEVKPKLEEGGHQASPCQFTVATPKVDPGPPGTLGLGLKPGQSL
LGPRDNRLSMGPFPNNVHTVEKSPFGGTAGPPAQLLTPNPLGGPGGASLLEKFDLESGGL
TLPGGPPPSGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQQPXXXXXXP
PPPPPQQQQQHPLLATSATAQSMPLPQEGPSPGLAVTPQQLALGLGARQSSLVSTQAMMT
TQQPSHALQQRLVPPMAMVPNQGHMLSGGQASLVPQQNPQPVLAQKPMGAVPPSMCMKPQ
QLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVPPGMNRQQ
VSLLAQRLSGAPGNTDLQNHVAAGSGQERSNSDPSQPRPNPPTFAHGVINEADQRQYEEW
LFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSK
IQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQQQQQQQHSAVLALSPSQSPRLL
AKLPGQLLPGHGLQPPQGPLGGQAGSLRLPPGGVTLTGQPSGPFLNPALGQQQQQQQHQA
GAGTLAGPSAGFFPGNLALRGLGADARLLQERQLQLQQQRMQLSQKLQQQQQQQHLLGQV
ALQQQQQQQQQQGLGPKPQGLLPPGSHQGLLVQQLSPQPTPGPQGMLGPAQVAVLQQQQQ
QVHPGGLGPQGPHRQVLLAQPRMLGSPQLAQQAQGLMAHRLVMAQQQQQQQQQQQQQQQQ
QQQQQQQQQALAGLSHLQQGLMPPSGQPKLGTQSMGTQQQQQLGLLNQGRTLLPPQQQQQ
QQLLPSPSSSLTQQQQQQQQQQQQQQQVALGPGLPAKPLQHFPSHGALGPTLLLSKGLPS
GLPGKEQAGAETVLVPEGTEAPSVHLGGPLALGAPTETLPPEPVEVKPSIPGDSHLLLSQ
PQPHTQMNSLQLQAPLRLPGQQQQQQQQQQVSLLHPAGSTSHGQMTGGQPPEVTSMSHLL
TQPLSSVGERPSGLDRPLKGSPRPPPPKPSPLPHPGQGLPGHSGMPTVGQLRAQLQGVLA
KNPQLRHLSPQQQQQLQALLVQRQLQQGQVLRQTVPYLEPGTQSSSLQGLLGRQPQPGGF
LGAPSGPLQELGAVPRPQGPSRLSTSQGAISSGSTLGFAQPPPLPSSPQEPKRPSPRLLP
PSPQLSAEVQLTPTQIENPKPQESSLELPSGDIPPPSSAASQLPDTFFAKGPGPWETPDN
LAEAHKTEQNNMGHGEVQQVNGQEMPEPPCLMIKQEPREEPCAMGAQLIKRETNGEPMGT
PGTSNHLLLASSRSEAGHLLLQKLLRAKNVQLGTGHGPEGLRAEINGHIDSKLAGLEQKL
QGTPVSKEDVAAKKPLTPKPKRVQKAGDRIASSRKKLRKEDGVKANEALLKQLKQELSLL
PLSEPNITNNFSLFAPFGSGCLINGRNQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTP
PSSLPPTPPPSVQQKLVNGVTPSEDLGEQQKDAAPARESEGGAREAPEVKSLDLLAALPT
PPHNQTEDVRMESDEESDSPDSIVPASSPESILGEEAPRFPQLVSGQQEQEDRALSPVIP
IIPRASIPVFPDAKPYGTLEVEPTGKLSATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVA
VAELLSMKIPSSYEVLFPESPARSAGAEPKKGEVEGPGGKEKSLGGKPTESGSDWLKQFD
AVLPGYTLKSQLDILSLLKQESPVPELPTQHCYIHNVSNLDVRQLSAPPPEEPSPPPSPS
APSPTSPPAEPSAPSPPPLVPSPPMPEAARPKPRARPPEEGEDSRPPRLKKWKGLRWKRL
RLLLTIQKGSGRREGEREVAEFMEQLGTALRPDKVPRDLRRCCFCHEEGDGATDGPARLL
NLDLDLWVHLNCALWSTEVYETQGGALMNVEGALHRGLLTKCSLCQRTGATNSCNRLRCP
SVYHFACAIRAKCMFFKDKTMLCPLHKLKGPCEQELSSFAVFRRVYIERDEVKQIASIIQ
RGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRC
SIIENNGRPEFIIKVMEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKG
EELFGLTVHAVLRIAESLPGVESCHNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYK
RPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLG
LYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPA
RYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAW
NCRKWMN
NT seq 15144 nt NT seq  +upstreamnt  +downstreamnt
atggacgacccgaagccctctggtgaagataaagattcagagccggcagctgatgggcct
gaagcctccgaagaatcaggccccactgagccagacccccccaacccacctttgggggat
gcctctgtccacagcccagggagttccaaatcccaggaccctccccaggattgcagcaag
ggcccacttcggcgctgtgccttctgtaactgtggggaatggagtctccatgggcagcgg
gagcttcggtgctttaaacttccaccagactggccccagggttcagcaaggccacctgag
gggcctggacttggagaggcagtgccactcaatgatgatttgtcccagattggcttcccc
gagggatcgacacctgcccatttgggaaagcctggtgaactctgctgggctcatcactgg
tgtgcagcatggtcagtgggaggacagggccaagatgggctggagttgcacggagtggac
aaggccatcttctcagggatctctcagcgctgctctcattgcaccaggctgggagcctcc
attccctgccgatcgcctggatgcccacggctctaccacttcccctgtgctgctgccagt
ggttccttccagtctatgaagaccttacagctgttgtgtttggagcatggcgaggaggct
gaacatctggaggatgcccattgtgtggtatgtgatgggctgggtgaacttcgagacctt
ctcttctgtaccagctgtgggcagcactatcatggggcctgtctggacactgctctgact
gcacgaaaacgtgccggctggcaatgcccggattgcaaagtgtgccaaacctgcaggcag
cctggggaggattctatgatgctagtctgtgaggcgtgtgataagggctaccacaccttc
tgcctgaagccagctattcagagcctgccccctgattcatggaagtgcaagacgtgccgg
gtgtgccgagcctgtggggcctgcccagcagagctggatcccaactgccagtggtatgag
aattactcattgtgtgagcggtgccagcggcagcagaacccccaaggtggaagggtggga
agctctgagaccgagcagagtctccatgtctgcagcaaatattctcagtcagagcttggc
atggcctccgttggtgcacctggcgattttgatactgcatgccaggaacagttggagggg
gagaaggaagcctgcaggaagtctgaggaaccagggccactgcattgtgaagccaaacca
ctaggtaaaggggtcctccagataaacagaggcaagcagggacccaagatgagtcactac
ctgaggtcctttccccacctgaggttgccccccttgatgaagagatgccactggagcccc
tgttactacctgaggagccactcctgtcacctcagctaccaccaacaggtacagaatact
gtacctctaaaatcttcctttttcctcccctttccagatcctcctcctcctccactctct
cctgccactgctgtagccccaccatccttgtctcccttgggggagcaagaggagctccct
gatgccaaaggggacagtgagccaggaactcctccagaggtccctatcctagacacaccc
atcagcccccctccagaagccagctgctttgaaccagaacccatagctcctatagacttg
accccttctccagcctcccccgaagaactgggagaactgaattctcccatccctctagag
ccccctcctccacagtgttcccctttaccattagccccttctcccctgggcttcatggag
aaggcaccaaaagtcctagatgagactgagtctcaggagatggagacagagccagagtgc
ccagctttggagcctagtgggatcagccccccagcctgtcccacaggagacctctcctgt
cctgcccctagccctgcccccagccctgccccggccctggatgtcttttctaatctggtt
gaggacacaatctgtcttgatgagactgaggcaactggtccggtgccagaggctggacag
acctctggcagttcaggcagtgatcctaaaggatcccccttgctccttgatcctgaggag
ctggcccctgtgacccctatggaggtctatggttccgatggtaagcaggctgggcagagc
tcaccttgtgaagatcctgaggagccagttgccccaccagtgcatacccctcccactctc
atcaagtctgacattgtcaatgagatctccaacctgagccaaggggacgccagcgccagc
ttcccgggctccgagcctctgttgggctccccagaccccgaggggggtggatcactctcc
atggagctcggtgtgtccactgacgtcagccctgcgcgggatgagggctcctttcggctc
tgcaccgattcactgcctgagactgatgactccttactttgtgattctggagcaactgga
gctggtggcaaggctgagggcgataaggggagacggcgaagctcccccgcccgttcccgc
atcaaacagggccgtagcagtagcttcccaggaagacgtcgacctcgggggggtgcccat
ggaggaagggggagaggacgtgcccggctgaagtcgaccacttcctctgtggagactctg
gtcgcggacattgatagttctcccagtaaggaggaagaagaggaagatgatgataccatg
cagaatactgtggttctcttttccaacaccgacaaatttgtcttgatgcaggatatgtgc
gtagtgtgtggtagctttggtcgaggggcagagggacacctcttggcctgctctcagtgt
tcacagtgctaccatccttactgtgtcaacagcaagattactaaagtgatgctcctgaaa
ggctggagatgtgtggaatgcatcgtgtgtgaggtgtgtggccaggcctctgacccatct
cgccttttgctctgcgatgactgtgacatcagctaccacacttactgtctggatccccct
ctgcttacagtgcccaagggtggctggaagtgcaaatggtgtgtgagttgcatgcagtgt
ggggctgtttcaccgggcttccactgtgagtggcagaacagttacacccactgtgggccc
tgtgccagcctggtgacctgcccagcatgtcgtgctccttatgtagaagaagatttgtta
atccagtgccgtcattgtgagcggtggatgcatgctggttgtgagagcttattcacagag
gaagaggtagaacaagcagcagatgaaggctttgattgtgcctcttgtcagccctatgtg
gtgaagcctgtggtgcccattgcgccaccagagctcgtgcctgtgaaggtgaaggagcca
gagccccagtacttccgctttgagggagtgtggctgacggagaccggcatggctgtgctt
cgaaatctgtccatgtcccccctccacaagcggcgtcagaggcgtgggcggcttggcctc
ctaggtgagggtgggctagaagggccggagccctcagaccccggtggccccgacgacaag
aaagatggggacctggaagctgaggagttgctcaagagcgaagttggtgtggagcacatg
gagtgtgagatcaagctggaggcccctgccagtcctgatggggagcctggcaaggaagaa
actgatgagggcaaaaagcgcaagcgaaaaccttacaggcctggcattgggggcttcatg
gttcgacagcgcaaatctcatgcccgtctgaagaaagggcccgctgtgttggtggaagtg
ttgagtggggagggccagcctgatgaggttgtgacagttgacccccctacagagggtgca
gtggagcagagtacagcggaaggtgatgagaagaagaagcgtcggggtcggaaaaagagc
aaactggaggacatgtttcctgcttacctgcaggaagccttctttgggaaggcactgttg
gaccttagccgaaaggcattgctggtggctggggatggacgaccaggctttgtgccaggc
actctcaggggtaagggggacccaggccctgatagaaaagagtcttctgcctcacagaaa
ggggatgatggaccagacattgcagatgaagagtccagaggccctgagggcaattcagag
actccaggccctgaagagggaggcatcaagacatctcctgtacccagtgactcagagaaa
ccagggaccccaggcgagggaatgctcagctctgacttggacaagatccccacagaagag
ctgcccaagatggaatcaaaggaccttcaacagttattcaaggatgtcctaggctcagag
cgggagcagcagattggctgtgggactcctaacttggatgggagtcacaccccaatgcag
cagaggcccttcctacaaggtgggcttcctttgggcaatctccctaccagcagcccaatg
gactcctacccaggcctttgccagtctcctttccttgataatagggagcgcgggggcttc
ttcagcccagagcctggtgagcctgacagcccctggacgggctcagggggcaccacaccc
tccacacccaccaccccaaccacggagggtgaaggcgatgggctctcctacaaccagcgg
agcctccagcgctgggaaaaggatgaggagctgggccagctgtctacaatctctcctgtg
ctctacgccaatattaattttcccaacctcaagcaggattatccagactgggccagtcgc
tgcaaacagatcatgaagctgtggagaaaagtcccggccactgacaaagccccctacctg
caaaaggccaaagataaccgggcggctcaccgcatcaacaaggtgcagaagcaggcggaa
agtcagatcagtaagcagaccaaggtgggcgacatagcccgcaaaaccgatcggcccacc
ctgcatctacgcattccccctcagccagggatgctgggcagtccccctccagcttctgct
ccgactgtcttcattggcagtccccctaccccagctggcttgtctacctcctcggatggg
ttcctgaagccgccagcaggcacagtgcctggccctgactcacctggtgatctcttcctc
aagctcccaccccaggtgcccgcccaagtgcctttgcaggacccttttggactggccccc
agctatactctggagtctcgcttccccacagcaccaccagcctaccccccctatcctggg
tcagcagtgccccctgcaaagcctcagatgctgggtgctccccctcggcctggggctggc
cagcctggagagttccaatccaccccgcctgggaccccaaggcaccagccttccacacct
gatccttttctcaagccccgctgcccttcactagacaacttggcaattccagagagtcca
ggggtgggtggagccaaggcatctgagcaactgatatcccctccaccctttggagagccg
cctcgaaaggccctagaagtaaagaaggaggagctaggagcagcctctcctggttatggc
ccccccagccttggttttggagactcgccttcctctgggccccacttaggcagcctggaa
ctaaaggcaccagatgtcttcaaagcccccctgacccctcgggcatctcaggtagagcct
cagagcccaggcataggcttgagaccccaggagcctccctctgcccatgctgtggccccc
tcaccccctagccatgcagacctatatcgtccaactccttctggttcctatcctgagacc
tattcgcagcccccactgacgccccggcctcagcctccacctcctgagagttgctgtccc
ctgccgcctcgctccttgccctccgatcccttcactcgagtacctgcgagcccccagtct
cagtctagctctcagtcgcccctgacaccccgtccgttgtccactgaagccttctgccag
tcgccggtcaccccttgcttccagtcacctgacccctactctcgcccaccctcacggccc
cagtcccgggacccttttgccccactacataagcctcctcggtcccagccccctgaagtt
gccttcaaggctgggcccctggcccatactccactaggagtagggggctttccggtagcc
ctgccctctgggcatcctaatgagcatcacactaagagttccggcggacagcctccatct
tttgtccgctctcctggggcaaatgtgtttgtgggcaatccttctgccatgcgcttcact
ttcccccaggcagtgggtgagccacccttgaagccccctgcctctcaacccagtcaccct
ccaccccatgggatcaacagccattatgggccaggacccactgtgggcaagccccaaagc
acaaactacacaacagctacaggcagtttccacccaggaggcagccccctggggccaggc
accgggccaccaggtgagggctatggtctgtctccgatgcgtccaccatcggttttacca
caaccagcaccagatggtcctctcgcttacctgccccatggtgcttcacagcgggggagc
atcacttccccaatcgataagcgagaagatccagtgtctgggatggccacctccctggtg
ggtcctgagctacaaggtccccaggaccccagcatggccaatctgagccagacagagttg
gagaagcagcggcagcgtcagcgtttgagagagctattgatccgacagcagattcaacgt
aacacccttcggcaagagaaggaaacagcagcagccacgagtgctgtagggccaggaaac
tggggcaccgagtccagcaaccctgcttttgagcaactgaatcgaggccccacctcctac
cctgggacacaggacaaaagtggccttacaggattgccccctaacaaactgagtggctcg
atgctgggacctagccccttccctgcagaggagagactctctcggcccccaccacctccc
accccttcttctattgacatgaatggccggcaactggttgggggcacccaagccttcttt
cctcgtgggcctttccctggacctctgcctcagcagcagcagcagcagctgtggcagcag
cagcagcagcagcaggctactgtggcttccatgcggctttccatgcctgcaaggttccct
caaccacctggacctgaacttggccggacaatcttaggccctcctttgagtgggctttcc
aaccggctgcccggaccaggggagccacttcctggtccagcaggtcctgctcaattcatt
gagcttcgtcacaatgtgcagaagggtccagggcctggcagtgccccttaccatcttcag
ggccctcctcagagacccagattcttcccagtagctgaggactcccaccgcctggctcca
gagagccttcggcccctggcggtacccgccctgcctccacagaagccttcggctcctcca
ccgcctgagctgagtaacagtctccactcccttccccatgccaagggtcccagccttcct
gctggcttggagctggttggtcgatctccttctagcacagagacagcacgtccacccctg
gttctagaatctgcaaaactgccctgtgaggaccccgagctggacgatgactttgatgcc
cataaagcacttgaagatgatgaggagctggcccacctggggatcggagtggatgtggcc
aagggggatgatgagctcggcaccctggggaacttggagaccaatgacccccatctggat
gacttgctaaatggggatgaatttgatctcttggcctacacagaccctgagctggacact
ggtgataagaaggacatatttaatgaacacttgcgactagtagaatctgctaatgagaag
gctgaacgtgaggcacttctgcggggcacagaacctggcttatctggccttgaggagcgc
ccagcccctaccactgatggccctgactcccatctcatgcctggggccagtgaagtaaag
cctaaattagaggagggtggacatcaggcttctccttgccagtttactgtggccaccccc
aaggtggacccggggcctcctggcaccctgggactggggctaaagcctggacagagcttg
ttgggaccacgggataacaggctgagcatgggtcccttccctaacaatgtgcatacagtg
gaaaagagtccctttggaggcacagcaggtcccccagctcagctactgaccccgaaccca
ttgggtggcccaggaggggcatccttgctggagaagtttgacctagagagtgggggccta
accctgcctggtgggcctccaccatctggagatgagctagacaagatggagagctccttg
gtggccagtgaactgcctttgctcattgaggaccttctggaacatgagaagaaagaactc
caaaagaaacaacagctctctgctcagctccagcagccnnnnnnnnnnnnnnnnncacca
ccgccgccaccaccgcagcagcagcagcagcaccccttgctggccacctctgccactgct
cagtccatgcctctgccccaagaaggtccatcccctggcctggctgttaccccacaacag
cttgcactagggcttggggcccggcagtccagcttagtgtccacccaggcaatgatgacc
actcagcaaccatctcatgccctgcaacagcgcctggtgcctcccatggccatggtgccc
aaccaaggccatatgctcagtggagggcaggcgagcttggtgcctcagcagaatccacag
ccagtgctggctcagaaacctatgggggcagtacccccatcgatgtgcatgaagccacag
cagctggcaatgcagcagcagctggccaacagcttcttccctgacacagacttggacaag
tttgctgcggaagatatcatcgatcctattgccaaggctaagatggtggccctaaagggt
atcaagaaagtgatggcacaaggcagcattggggtgccaccaggcatgaacaggcaacag
gtgtccctcttggcccagcggctctcaggagctcctggcaacactgacctacagaatcat
gtggcagctgggagtgggcaggaaaggagcaacagtgacccctcccagcctcgacctaat
ccacccacttttgcccatggtgtgatcaatgaagctgaccagcggcagtatgaggaatgg
ctatttcacacccagcaactgctacagatgcagctcaaagtgctagaggagcagattggg
gtacaccggaagtcccgaaaggccctgtgcgccaaacagcgcaccgctaaaaaggctggc
cgagaattcccagaggccgatgcggagaagctcaagttggtcactgagcagcagagcaaa
atccagaagcagctggaccaggttcggaaacagcagaaggagcacacaaacctcatggca
gagtatcggaataagcagcagcagcagcagcagcagcaacaacagcagcagcagcagcag
cagcagcagcagcattctgcagtgctggccttgagcccctctcagagccctaggctactg
gccaagctccccggccagctactcccaggccatgggttacagcctccacaggggcccctg
ggtggccaggcaggcagccttcgcctgccccctggaggggttacacttactggccagccc
agtggcccgttcctcaatccagccctgggccagcagcagcagcagcagcaacatcaagct
ggggcaggcactctagcaggcccctcagctggcttcttccctgggaatcttgctctccga
ggcctgggtgctgatgcaaggctcttacaggagcggcaactccagctgcagcagcagagg
atgcagctgtctcagaagctacagcagcagcagcagcaacagcaccttttgggacaggta
gccctgcagcagcagcaacagcagcagcagcagcaaggcctgggaccaaagccccaggga
ctcctgcctcctggcagtcatcagggcctcttggtccagcagctgtccccccagccaacc
ccagggccccaaggcatgctgggccctgcccaggtagcagtgctgcagcaacagcagcag
caggtacaccctggggggctgggtccccaaggtccccacagacaagtactccttgcccaa
cctcgaatgctggggtctcctcaactggcccagcaagcacaaggcctaatggcccaccga
cttgttatggcccagcaacaacagcaacaacagcagcagcagcagcagcagcaacagcag
cagcagcagcagcaacagcagcagcaagccctggctggtctctcccatctccagcaagga
ttgatgcctcctagtgggcagcccaagttaggcacccagtctatggggacacaacagcag
cagcagctggggctcctgaaccagggtcgaactttattgcctccccagcagcaacaacag
caacaattgttgccatctccatccagctcccttacccagcagcagcagcagcagcagcag
cagcagcagcagcagcagcaggtggccctgggtcctggcttgcctgccaaacctctccag
cactttcccagccatggagccttaggcccaacccttttgctgagcaaggggttgccctca
ggcttaccaggcaaggagcaagctggggcagagacagtgctagtacctgagggcactgaa
gccccctcagtgcacctaggaggaccgttggcattgggtgccccaacagaaaccctgccc
ccagagccagtggaggtgaagccctctatccctggggactctcacctcctcctctcccaa
ccccaacctcatactcagatgaactccctgcagttacaggcacctctgagactcccaggg
cagcagcagcagcagcagcagcaacagcaagtcagcttactccatccagcaggcagtaca
agtcatgggcaaatgactggtgggcaacccccagaagttacttccatgtcccacctgctg
acccagccccttagttctgtaggggagcggccatctgggctggatcgacccttgaaaggg
agcccaaggccaccgcctcccaagccaagccctctaccccaccctgggcagggcctacct
gggcattcaggaatgcccacagtggggcagcttcgggcccagcttcaaggtgtcctggct
aagaacccacagcttcggcacctgagccctcaacagcaacagcagctgcaggcccttctt
gttcagaggcaactgcagcaaggccaggtgctaagacaaacagtgccctatctggagcct
gggacccagtcttcttccttgcaaggcctcctaggtcgccagccccaacctgggggcttc
ctgggagctccatcagggcctctccaagagctaggggcagtgccccgacctcagggccct
tcccgactctccacctcacaaggagccatatcttcagggtcaacccttggctttgcacag
ccccctcctttgccatccagccctcaagagccaaagagaccttccccccgattgctgccc
cctagccctcagctttctgctgaggttcagctcactcctacccagattgagaacccaaag
ccccaagaatcttccttggagttaccttcaggggacattccacccccctcatctgctgcc
tctcagcttccagacactttctttgccaagggaccgggaccttgggaaaccccggacaac
ctggctgaggcccataagactgagcagaacaacatgggacatggagaggtgcagcaggtg
aatggacaggaaatgccggagccaccctgcctcatgatcaagcaggagcctcgagaggag
ccttgtgccatgggggcccagttgataaaacgggagactaatggagagcctatgggcaca
ccaggcaccagcaaccacctcttactggcaagcagccgctcagaggctgggcacctgctc
ttgcagaagctgcttcgggcaaagaatgtacagcttggcacagggcatggacccgagggg
ctccgagcagagatcaatgggcacattgacagcaagctggctggtttggagcagaagctt
cagggcactccagtcagcaaggaggatgttgcagccaagaaaccactcacccccaaaccc
aagagggtacagaaggcaggggacaggatagcaagctcccgaaagaagctccggaaggaa
gatggggtgaaagccaatgaggccctgttgaaacaactaaagcaggaactgtccttgctg
ccactttcggaacccaacatcaccaacaacttcagcctttttgccccctttggcagtggc
tgcctcatcaatgggcggaaccagctgaggggggcatttgggagcggggcactacccact
ggccctgactactattcccagcttcttacaaagaataacctgagtaacccgcctacgcca
ccttcctcactgccacctaccccacccccatcagtacagcagaaattggtgaatggggtc
actccttctgaagaccttggggaacaacaaaaagatgcagcccctgcccgagaatctgaa
gggggagcaagggaagcccctgaagtgaagagtttggacctgctggcagcacttcccaca
cctcctcacaaccagactgaggatgtcaggatggagagtgatgaggagagtgactcccct
gacagcatcgttccagcttcttcacctgagagtattctaggggaggaggcacctagattt
ccccaactggtatcaggccagcaggagcaggaggatagggccctctccccagtcattccc
atcatcccccgggccagcatcccagtcttcccagatgccaagccctatgggactctggaa
gtagaaccaacaggaaagctttctgccaccacctgggaaaagggcaaagggagtgaagtg
tccgtcatgctgactgtctctgctgcagcagccaagaatctgaatggggtcatggtggct
gtggcagagctgttgagcatgaagattcccagctcctatgaggtgctgttcccagagagc
cctgcccgctcagcgggtgctgagcccaagaagggggaagtggaagggcctggtggtaaa
gagaaaagccttgggggaaagcccacggagagtggcagtgactggctgaaacagtttgat
gcagtgctgccaggctacaccctcaagagccagctggacatcttgagccttctcaagcag
gaaagtcctgtcccagagctgcccacccaacactgctacatccacaacgtctccaacctg
gatgtccgtcagctctctgccccgccccctgaagagccttccccacccccttcaccctca
gctccttcccccaccagccctccagccgaaccttcggctccgtcacctccacccctggtt
ccctcacctccgatgcctgaggcggctcgccccaagcccagagcacggccccctgaagag
ggtgaggattctcgacctccccggctaaagaaatggaaagggcttcgctggaaacggtta
cgcctgctgctgacgatccagaagggcagtgggcgacgggagggtgaacgggaggtagct
gaattcatggagcaattgggcacagccctccgacctgacaaagtgccccgtgaccttcgg
cgctgctgcttctgccatgaagagggtgatggcgctaccgacgggcctgcccggctcctc
aacctggatctagacttgtgggttcatctcaactgtgccctgtggtccacggaggtctat
gaaactcaggggggggccctgatgaatgttgagggggccctgcaccgggggcttctgacc
aagtgctcactgtgccagcgtacgggagccaccaacagctgtaacagactgcgctgtccc
agtgtctaccactttgcctgtgccatccgggccaagtgcatgttcttcaaggataagact
atgctgtgccccctgcacaagctgaaagggccctgtgagcaggagctgagctcttttgcc
gtctttcgccgtgtctacatcgagcgggatgaggtaaagcagatagccagcatcatccaa
cgtggtgagcggctccacatgttccgggtagggggcctggtgttccacgccatcgggcag
cttctgccccaccagatggccgacttccacagtgctacagccctctaccctgttggctac
gaggccactcgcatctactggagcttacgcaccaacaaccgccgatgctgttaccgctgc
tccatcattgagaacaatgggcggcccgagttcatcatcaaggtcatggaacagggcttg
gaggacctggtcttcactgatgcatcccctcaggctgtgtggaatcgtatcattgagcca
gtggctgccatgcgcaaggaagccgacatgcttcggttattcccggagtatcttaaggga
gaggagctctttgggttgacagtacatgctgtcctacggattgcagaatcgctgcctggg
gtggaaagctgtcacaactacttgtttcgatatggacggcacccactgatggaattgcca
cttatgatcaaccctactggctgtgcccgctctgagcccaaaattctcactcactacaaa
cggcctcacaccctcaacagcaccagcatgtccaaggcttaccagagcaccttcacaggt
gagaccaacaccccgtacagcaaacagtttgtgcactccaagtcatcccagtatcggcgg
ctgcgcactgagtggaagaacaacgtctacctggctcgatctcgaattcagggcctgggg
ctgtatgctgccaaggacctggagaagcacacaatggtcatcgagtacattggcaccatc
atccgcaatgaggtggccaaccgtcgtgagaagatctacgaggagcagaatcgaggtatc
tatatgtttcggataaacaatgagcatgtgattgatgccacactgactggagggcctgcc
aggtacataaaccattcatgtgcccccaactgtgtggcagaggttgtgacctttgataaa
gaggataagatcattatcatctctagccggcgcatccccaaaggagaggagctgacctat
gactatcagtttgactttgaggatgatcagcacaaaatcccctgccattgtggagcctgg
aactgccggaagtggatgaactaa

DBGET integrated database retrieval system