KEGG   Sarcophilus harrisii (Tasmanian devil): 100928575Help
Entry
100928575         CDS       T02286                                 

Gene name
KMT2D, MLL2
Definition
(RefSeq) lysine (K)-specific methyltransferase 2D
  KO
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100928575 (KMT2D)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100928575 (KMT2D)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100928575 (KMT2D)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100928575 (KMT2D)
   HMT complexes
    MLL-HCF complex
     100928575 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 5023 aa AA seqDB search
MDDPKPSGEDKDSEPAADGPEASEESGPTEPDPPNPPLGDASVHSPGSSKSQDPPQDCSK
GPLRRCAFCNCGEWSLHGQRELRCFKLPPDWPQGSARPPEGPGLGEAVPLNDDLSQIGFP
EGSTPAHLGKPGELCWAHHWCAAWSVGGQGQDGLELHGVDKAIFSGISQRCSHCTRLGAS
IPCRSPGCPRLYHFPCAAASGSFQSMKTLQLLCLEHGEEAEHLEDAHCVVCDGLGELRDL
LFCTSCGQHYHGACLDTALTARKRAGWQCPDCKVCQTCRQPGEDSMMLVCEACDKGYHTF
CLKPAIQSLPPDSWKCKTCRVCRACGACPAELDPNCQWYENYSLCERCQRQQNPQGGRVG
SSETEQSLHVCSKYSQSELGMASVGAPGDFDTACQEQLEGEKEACRKSEEPGPLHCEAKP
LGQAGTQDESLPEVLSPPEVAPLDEEMPLEPLLLPEEPLLSPQLPPTDPPPPPLSPATAV
APPSLSPLGEQEELPDAKGDSEPGTPPEVPILDTPISPPPEASCFEPEPIAPIDLTPSPA
SPEELGELNSPIPLEPPPPQCSPLPLAPSPLGFMEKAPKVLDETESQEMETEPECPALEP
SGISPPACPTGDLSCPAPSPAPSPAPALDVFSNLVEDTICLDETEATGPVPEAGQTSGSS
GSDPKGSPLLLDPEELAPVTPMEVYGSDGKQAGQSSPCEDPEEPVAPPVHTPPTLIKSDI
VNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSFRLCTDSL
PETDDSLLCDSGATGAGGKAEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGR
GRARLKSTTSSVETLVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDKFVLMQDMCVVCGS
FGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLC
DDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAVSPGFHCEWQNSYTHCGPCASLV
TCPACRAPYVEEDLLIQCRHCERWMHAGCESLFTEEEVEQAADEGFDCASCQPYVVKPVV
PIAPPELVPVKVKEPEPQYFRFEGVWLTETGMAVLRNLSMSPLHKRRQRRGRLGLLGEGG
LEGPEPSDPGGPDDKKDGDLEAEELLKSEGVGVEHMECEIKLEAPASPDGEPGKEETDEG
KKRKRKPYRPGIGGFMVRQRKSHARLKKGPAVLVEVLSGEGQPDEVVTVDPPTEGAVEQS
TAEGDEKKKRRGRKKSKLEDMFPAYLQEAFFGKALLDLSRKALLVAGDGRPGFVPGTLRG
KGDPGPDRKESSASQKGDDGPDIADEESRGPEGNSETPGPEEGGIKTSPVPSDSEKPGTP
GEGMLSSDLDKIPTEELPKMESKDLQQLFKDVLGSEREQQIGCGTPNLDGSHTPMQQRPF
LQGGLPLGNLPTSSPMDSYPGLCQSPFLDNRERGGFFSPEPGEPDSPWTGSGGTTPSTPT
TPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWASRCKQI
MKLWRKVPATDKAPYLQKAKDNRAAHRINKVQKQAESQISKQTKVGDIARKTDRPTLHLR
IPPQPGMLGSPPPASAPTVFIGSPPTPAGLSTSSDGFLKPPAGTVPGPDSPGDLFLKLPP
QVPAQVPLQDPFGLAPSYTLESRFPTAPPAYPPYPGSAVPPAKPQMLGAPPRPGAGQPGE
FQSTPPGTPRHQPSTPDPFLKPRCPSLDNLAIPESPGVGGAKASEQLISPPPFGEPPRKA
LEVKKEELGAASPGYGPPSLGFGDSPSSGPHLGSLELKAPDVFKAPLTPRASQVEPQSPG
IGLRPQEPPSAHAVAPSPPSHADLYRPTPSGSYPETYSQPPLTPRPQPPPPESCCPLPPR
SLPSDPFTRVPASPQSQSSSQSPLTPRPLSTEAFCQSPVTPCFQSPDPYSRPPSRPQSRD
PFAPLHKPPRSQPPEVAFKAGPLAHTPLGVGGFPVALPSGHPNEHHTKSSGGQPPSFVRS
PGANVFVGNPSAMRFTFPQAVGEPPLKPPASQPSHPPPHGINSHYGPGPTVGKPQSTNYT
TATGSFHPGGSPLGPGTGPPGEGYGLSPMRPPSVLPQPAPDGPLAYLPHGASQRGSITSP
IDKREDPVSGMATSLVGPELQGPQDPSMANLSQTELEKQRQRQRLRELLIRQQIQRNTLR
QEKETAAATSAVGPGNWGTESSNPAFEQLNRGPTSYPGTQDKSGLTGLPPNKLSGSMLGP
SPFPAEERLSRPPPPPTPSSIDMNGRQLVGGTQAFFPRGPFPGPLPQQQQQQLWQQQQQQ
QATVASMRLSMPARFPQPPGPELGRTILGPPLSGLSNRLPGPGEPLPGPAGPAQFIELRH
NVQKGPGPGSAPYHLQGPPQRPRFFPVAEDSHRLAPESLRPLAVPALPPQKPSAPPPPEL
SNSLHSLPHAKGPSLPAGLELVGRSPSSTETARPPLVLESAKLPCEDPELDDDFDAHKAL
EDDEELAHLGIGVDVAKGDDELGTLGNLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKK
DIFNEHLRLVESANEKAEREALLRGTEPGLSGLEERPAPTTDGPDSHLMPGASEVKPKLE
EGGHQASPCQFTVATPKVDPGPPGTLGLGLKPGQSLLGPRDNRLSMGPFPNNVHTVEKSP
FGGTAGPPAQLLTPNPLGGPGGASLLEKFDLESGGLTLPGGPPPSGDELDKMESSLVASE
LPLLIEDLLEHEKKELQKKQQLSAQLQQPXXXXXXPPPPPPQQQQQHPLLATSATAQSMP
LPQEGPSPGLAVTPQQLALGLGARQSSLVSTQAMMTTQQPSHALQQRLVPPMAMVPNQGH
MLSGGQASLVPQQNPQPVLAQKPMGAVPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAE
DIIDPIAKAKMVALKGIKKVMAQGSIGVPPGMNRQQVSLLAQRLSGAPGNTDLQNHVAAG
SGQERSNSDPSQPRPNPPTFAHGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRK
SRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRN
KQQQQQQQQQQQQQQQQQQQHSAVLALSPSQSPRLLAKLPGQLLPGHGLQPPQGPLGGQA
GSLRLPPGGVTLTGQPSGPFLNPALGQQQQQQQHQAGAGTLAGPSAGFFPGNLALRGLGA
DARLLQERQLQLQQQRMQLSQKLQQQQQQQHLLGQVALQQQQQQQQQQGLGPKPQGLLPP
GSHQGLLVQQLSPQPTPGPQGMLGPAQVAVLQQQQQQVHPGGLGPQGPHRQVLLAQPRML
GSPQLAQQAQGLMAHRLVMAQQQQQQQQQQQQQQQQQQQQQQQQQALAGLSHLQQGLMPP
SGQPKLGTQSMGTQQQQQLGLLNQGRTLLPPQQQQQQQLLPSPSSSLTQQQQQQQQQQQQ
QQQVALGPGLPAKPLQHFPSHGALGPTLLLSKGLPSGLPGKEQAGAETVLVPEGTEAPSV
HLGGPLALGAPTETLPPEPVEVKPSIPGDSHLLLSQPQPHTQMNSLQLQAPLRLPGQQQQ
QQQQQQVSLLHPAGSTSHGQMTGGQPPEVTSMSHLLTQPLSSVGERPSGLDRPLKGSPRP
PPPKPSPLPHPGQGLPGHSGMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLVQRQ
LQQGQVLRQTVPYLEPGTQSSSLQGLLGRQPQPGGFLGAPSGPLQELGAVPRPQGPSRLS
TSQGAISSGSTLGFAQPPPLPSSPQEPKRPSPRLLPPSPQLSAEVQLTPTQIENPKPQES
SLELPSGDIPPPSSAASQLPDTFFAKGPGPWETPDNLAEAHKTEQNNMGHGEVQQVNGQE
MPEPPCLMIKQEPREEPCAMGAQLIKRETNGEPMGTPGTSNHLLLASSRSEAGHLLLQKL
LRAKNVQLGTGHGPEGLRAEINGHIDSKLAGLEQKLQGTPVSKEDVAAKKPLTPKPKRVQ
KAGDRIASSRKKLRKEDGVKANEALLKQLKQELSLLPLSEPNITNNFSLFAPFGSGCLIN
GRNQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKLVNGVTPSE
DLGEQQKDAAPARESEGGAREAPEVKSLDLLAALPTPPHNQTEDVRMESDEESDSPDSIV
PASSPESILGEEAPRFPQLVSGQQEQEDRALSPVIPIIPRASIPVFPDAKPYGTLEVEPT
GKLSATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPSSYEVLFPESPARS
AGAEPKKGEVEGPGGKEKSLGGKPTESGSDWLKQFDAVLPGYTLKSQLDILSLLKQESPV
PELPTQHCYIHNVSNLDVRQLSAPPPEEPSPPPSPSAPSPTSPPAEPSAPSPPPLVPSPP
MPEAARPKPRARPPEEGEDSRPPRLKKWKGLRWKRLRLLLTIQKGSGRREGEREVAEFME
QLGTALRPDKVPRDLRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQG
GALMNVEGALHRGLLTKCSLCQRTGATNSCNRLRCPSVYHFACAIRAKCMFFKDKTMLCP
LHKLKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPH
QMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIIENNGRPEFIIKVMEQGLEDLV
FTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESC
HNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNT
PYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNE
VANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKI
IIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 15072 nt NT seq  +upstreamnt  +downstreamnt
atggacgacccgaagccctctggtgaagataaagattcagagccggcagctgatgggcct
gaagcctccgaagaatcaggccccactgagccagacccccccaacccacctttgggggat
gcctctgtccacagcccagggagttccaaatcccaggaccctccccaggattgcagcaag
ggcccacttcggcgctgtgccttctgtaactgtggggaatggagtctccatgggcagcgg
gagcttcggtgctttaaacttccaccagactggccccagggttcagcaaggccacctgag
gggcctggacttggagaggcagtgccactcaatgatgatttgtcccagattggcttcccc
gagggatcgacacctgcccatttgggaaagcctggtgaactctgctgggctcatcactgg
tgtgcagcatggtcagtgggaggacagggccaagatgggctggagttgcacggagtggac
aaggccatcttctcagggatctctcagcgctgctctcattgcaccaggctgggagcctcc
attccctgccgatcgcctggatgcccacggctctaccacttcccctgtgctgctgccagt
ggttccttccagtctatgaagaccttacagctgttgtgtttggagcatggcgaggaggct
gaacatctggaggatgcccattgtgtggtatgtgatgggctgggtgaacttcgagacctt
ctcttctgtaccagctgtgggcagcactatcatggggcctgtctggacactgctctgact
gcacgaaaacgtgccggctggcaatgcccggattgcaaagtgtgccaaacctgcaggcag
cctggggaggattctatgatgctagtctgtgaggcgtgtgataagggctaccacaccttc
tgcctgaagccagctattcagagcctgccccctgattcatggaagtgcaagacgtgccgg
gtgtgccgagcctgtggggcctgcccagcagagctggatcccaactgccagtggtatgag
aattactcattgtgtgagcggtgccagcggcagcagaacccccaaggtggaagggtggga
agctctgagaccgagcagagtctccatgtctgcagcaaatattctcagtcagagcttggc
atggcctccgttggtgcacctggcgattttgatactgcatgccaggaacagttggagggg
gagaaggaagcctgcaggaagtctgaggaaccagggccactgcattgtgaagccaaacca
ctagggcaagcagggacccaagatgagtcactacctgaggtcctttccccacctgaggtt
gccccccttgatgaagagatgccactggagcccctgttactacctgaggagccactcctg
tcacctcagctaccaccaacagatcctcctcctcctccactctctcctgccactgctgta
gccccaccatccttgtctcccttgggggagcaagaggagctccctgatgccaaaggggac
agtgagccaggaactcctccagaggtccctatcctagacacacccatcagcccccctcca
gaagccagctgctttgaaccagaacccatagctcctatagacttgaccccttctccagcc
tcccccgaagaactgggagaactgaattctcccatccctctagagccccctcctccacag
tgttcccctttaccattagccccttctcccctgggcttcatggagaaggcaccaaaagtc
ctagatgagactgagtctcaggagatggagacagagccagagtgcccagctttggagcct
agtgggatcagccccccagcctgtcccacaggagacctctcctgtcctgcccctagccct
gcccccagccctgccccggccctggatgtcttttctaatctggttgaggacacaatctgt
cttgatgagactgaggcaactggtccggtgccagaggctggacagacctctggcagttca
ggcagtgatcctaaaggatcccccttgctccttgatcctgaggagctggcccctgtgacc
cctatggaggtctatggttccgatggtaagcaggctgggcagagctcaccttgtgaagat
cctgaggagccagttgccccaccagtgcatacccctcccactctcatcaagtctgacatt
gtcaatgagatctccaacctgagccaaggggacgccagcgccagcttcccgggctccgag
cctctgttgggctccccagaccccgaggggggtggatcactctccatggagctcggtgtg
tccactgacgtcagccctgcgcgggatgagggctcctttcggctctgcaccgattcactg
cctgagactgatgactccttactttgtgattctggagcaactggagctggtggcaaggct
gagggcgataaggggagacggcgaagctcccccgcccgttcccgcatcaaacagggccgt
agcagtagcttcccaggaagacgtcgacctcgggggggtgcccatggaggaagggggaga
ggacgtgcccggctgaagtcgaccacttcctctgtggagactctggtcgcggacattgat
agttctcccagtaaggaggaagaagaggaagatgatgataccatgcagaatactgtggtt
ctcttttccaacaccgacaaatttgtcttgatgcaggatatgtgcgtagtgtgtggtagc
tttggtcgaggggcagagggacacctcttggcctgctctcagtgttcacagtgctaccat
ccttactgtgtcaacagcaagattactaaagtgatgctcctgaaaggctggagatgtgtg
gaatgcatcgtgtgtgaggtgtgtggccaggcctctgacccatctcgccttttgctctgc
gatgactgtgacatcagctaccacacttactgtctggatccccctctgcttacagtgccc
aagggtggctggaagtgcaaatggtgtgtgagttgcatgcagtgtggggctgtttcaccg
ggcttccactgtgagtggcagaacagttacacccactgtgggccctgtgccagcctggtg
acctgcccagcatgtcgtgctccttatgtagaagaagatttgttaatccagtgccgtcat
tgtgagcggtggatgcatgctggttgtgagagcttattcacagaggaagaggtagaacaa
gcagcagatgaaggctttgattgtgcctcttgtcagccctatgtggtgaagcctgtggtg
cccattgcgccaccagagctcgtgcctgtgaaggtgaaggagccagagccccagtacttc
cgctttgagggagtgtggctgacggagaccggcatggctgtgcttcgaaatctgtccatg
tcccccctccacaagcggcgtcagaggcgtgggcggcttggcctcctaggtgagggtggg
ctagaagggccggagccctcagaccccggtggccccgacgacaagaaagatggggacctg
gaagctgaggagttgctcaagagcgaaggagttggtgtggagcacatggagtgtgagatc
aagctggaggcccctgccagtcctgatggggagcctggcaaggaagaaactgatgagggc
aaaaagcgcaagcgaaaaccttacaggcctggcattgggggcttcatggttcgacagcgc
aaatctcatgcccgtctgaagaaagggcccgctgtgttggtggaagtgttgagtggggag
ggccagcctgatgaggttgtgacagttgacccccctacagagggtgcagtggagcagagt
acagcggaaggtgatgagaagaagaagcgtcggggtcggaaaaagagcaaactggaggac
atgtttcctgcttacctgcaggaagccttctttgggaaggcactgttggaccttagccga
aaggcattgctggtggctggggatggacgaccaggctttgtgccaggcactctcaggggt
aagggggacccaggccctgatagaaaagagtcttctgcctcacagaaaggggatgatgga
ccagacattgcagatgaagagtccagaggccctgagggcaattcagagactccaggccct
gaagagggaggcatcaagacatctcctgtacccagtgactcagagaaaccagggacccca
ggcgagggaatgctcagctctgacttggacaagatccccacagaagagctgcccaagatg
gaatcaaaggaccttcaacagttattcaaggatgtcctaggctcagagcgggagcagcag
attggctgtgggactcctaacttggatgggagtcacaccccaatgcagcagaggcccttc
ctacaaggtgggcttcctttgggcaatctccctaccagcagcccaatggactcctaccca
ggcctttgccagtctcctttccttgataatagggagcgcgggggcttcttcagcccagag
cctggtgagcctgacagcccctggacgggctcagggggcaccacaccctccacacccacc
accccaaccacggagggtgaaggcgatgggctctcctacaaccagcggagcctccagcgc
tgggaaaaggatgaggagctgggccagctgtctacaatctctcctgtgctctacgccaat
attaattttcccaacctcaagcaggattatccagactgggccagtcgctgcaaacagatc
atgaagctgtggagaaaagtcccggccactgacaaagccccctacctgcaaaaggccaaa
gataaccgggcggctcaccgcatcaacaaggtgcagaagcaggcggaaagtcagatcagt
aagcagaccaaggtgggcgacatagcccgcaaaaccgatcggcccaccctgcatctacgc
attccccctcagccagggatgctgggcagtccccctccagcttctgctccgactgtcttc
attggcagtccccctaccccagctggcttgtctacctcctcggatgggttcctgaagccg
ccagcaggcacagtgcctggccctgactcacctggtgatctcttcctcaagctcccaccc
caggtgcccgcccaagtgcctttgcaggacccttttggactggcccccagctatactctg
gagtctcgcttccccacagcaccaccagcctaccccccctatcctgggtcagcagtgccc
cctgcaaagcctcagatgctgggtgctccccctcggcctggggctggccagcctggagag
ttccaatccaccccgcctgggaccccaaggcaccagccttccacacctgatccttttctc
aagccccgctgcccttcactagacaacttggcaattccagagagtccaggggtgggtgga
gccaaggcatctgagcaactgatatcccctccaccctttggagagccgcctcgaaaggcc
ctagaagtaaagaaggaggagctaggagcagcctctcctggttatggcccccccagcctt
ggttttggagactcgccttcctctgggccccacttaggcagcctggaactaaaggcacca
gatgtcttcaaagcccccctgacccctcgggcatctcaggtagagcctcagagcccaggc
ataggcttgagaccccaggagcctccctctgcccatgctgtggccccctcaccccctagc
catgcagacctatatcgtccaactccttctggttcctatcctgagacctattcgcagccc
ccactgacgccccggcctcagcctccacctcctgagagttgctgtcccctgccgcctcgc
tccttgccctccgatcccttcactcgagtacctgcgagcccccagtctcagtctagctct
cagtcgcccctgacaccccgtccgttgtccactgaagccttctgccagtcgccggtcacc
ccttgcttccagtcacctgacccctactctcgcccaccctcacggccccagtcccgggac
ccttttgccccactacataagcctcctcggtcccagccccctgaagttgccttcaaggct
gggcccctggcccatactccactaggagtagggggctttccggtagccctgccctctggg
catcctaatgagcatcacactaagagttccggcggacagcctccatcttttgtccgctct
cctggggcaaatgtgtttgtgggcaatccttctgccatgcgcttcactttcccccaggca
gtgggtgagccacccttgaagccccctgcctctcaacccagtcaccctccaccccatggg
atcaacagccattatgggccaggacccactgtgggcaagccccaaagcacaaactacaca
acagctacaggcagtttccacccaggaggcagccccctggggccaggcaccgggccacca
ggtgagggctatggtctgtctccgatgcgtccaccatcggttttaccacaaccagcacca
gatggtcctctcgcttacctgccccatggtgcttcacagcgggggagcatcacttcccca
atcgataagcgagaagatccagtgtctgggatggccacctccctggtgggtcctgagcta
caaggtccccaggaccccagcatggccaatctgagccagacagagttggagaagcagcgg
cagcgtcagcgtttgagagagctattgatccgacagcagattcaacgtaacacccttcgg
caagagaaggaaacagcagcagccacgagtgctgtagggccaggaaactggggcaccgag
tccagcaaccctgcttttgagcaactgaatcgaggccccacctcctaccctgggacacag
gacaaaagtggccttacaggattgccccctaacaaactgagtggctcgatgctgggacct
agccccttccctgcagaggagagactctctcggcccccaccacctcccaccccttcttct
attgacatgaatggccggcaactggttgggggcacccaagccttctttcctcgtgggcct
ttccctggacctctgcctcagcagcagcagcagcagctgtggcagcagcagcagcagcag
caggctactgtggcttccatgcggctttccatgcctgcaaggttccctcaaccacctgga
cctgaacttggccggacaatcttaggccctcctttgagtgggctttccaaccggctgccc
ggaccaggggagccacttcctggtccagcaggtcctgctcaattcattgagcttcgtcac
aatgtgcagaagggtccagggcctggcagtgccccttaccatcttcagggccctcctcag
agacccagattcttcccagtagctgaggactcccaccgcctggctccagagagccttcgg
cccctggcggtacccgccctgcctccacagaagccttcggctcctccaccgcctgagctg
agtaacagtctccactcccttccccatgccaagggtcccagccttcctgctggcttggag
ctggttggtcgatctccttctagcacagagacagcacgtccacccctggttctagaatct
gcaaaactgccctgtgaggaccccgagctggacgatgactttgatgcccataaagcactt
gaagatgatgaggagctggcccacctggggatcggagtggatgtggccaagggggatgat
gagctcggcaccctggggaacttggagaccaatgacccccatctggatgacttgctaaat
ggggatgaatttgatctcttggcctacacagaccctgagctggacactggtgataagaag
gacatatttaatgaacacttgcgactagtagaatctgctaatgagaaggctgaacgtgag
gcacttctgcggggcacagaacctggcttatctggccttgaggagcgcccagcccctacc
actgatggccctgactcccatctcatgcctggggccagtgaagtaaagcctaaattagag
gagggtggacatcaggcttctccttgccagtttactgtggccacccccaaggtggacccg
gggcctcctggcaccctgggactggggctaaagcctggacagagcttgttgggaccacgg
gataacaggctgagcatgggtcccttccctaacaatgtgcatacagtggaaaagagtccc
tttggaggcacagcaggtcccccagctcagctactgaccccgaacccattgggtggccca
ggaggggcatccttgctggagaagtttgacctagagagtgggggcctaaccctgcctggt
gggcctccaccatctggagatgagctagacaagatggagagctccttggtggccagtgaa
ctgcctttgctcattgaggaccttctggaacatgagaagaaagaactccaaaagaaacaa
cagctctctgctcagctccagcagccnnnnnnnnnnnnnnnnncaccaccgccgccacca
ccgcagcagcagcagcagcaccccttgctggccacctctgccactgctcagtccatgcct
ctgccccaagaaggtccatcccctggcctggctgttaccccacaacagcttgcactaggg
cttggggcccggcagtccagcttagtgtccacccaggcaatgatgaccactcagcaacca
tctcatgccctgcaacagcgcctggtgcctcccatggccatggtgcccaaccaaggccat
atgctcagtggagggcaggcgagcttggtgcctcagcagaatccacagccagtgctggct
cagaaacctatgggggcagtacccccatcgatgtgcatgaagccacagcagctggcaatg
cagcagcagctggccaacagcttcttccctgacacagacttggacaagtttgctgcggaa
gatatcatcgatcctattgccaaggctaagatggtggccctaaagggtatcaagaaagtg
atggcacaaggcagcattggggtgccaccaggcatgaacaggcaacaggtgtccctcttg
gcccagcggctctcaggagctcctggcaacactgacctacagaatcatgtggcagctggg
agtgggcaggaaaggagcaacagtgacccctcccagcctcgacctaatccacccactttt
gcccatggtgtgatcaatgaagctgaccagcggcagtatgaggaatggctatttcacacc
cagcaactgctacagatgcagctcaaagtgctagaggagcagattggggtacaccggaag
tcccgaaaggccctgtgcgccaaacagcgcaccgctaaaaaggctggccgagaattccca
gaggccgatgcggagaagctcaagttggtcactgagcagcagagcaaaatccagaagcag
ctggaccaggttcggaaacagcagaaggagcacacaaacctcatggcagagtatcggaat
aagcagcagcagcagcagcagcagcaacaacagcagcagcagcagcagcagcagcagcag
cattctgcagtgctggccttgagcccctctcagagccctaggctactggccaagctcccc
ggccagctactcccaggccatgggttacagcctccacaggggcccctgggtggccaggca
ggcagccttcgcctgccccctggaggggttacacttactggccagcccagtggcccgttc
ctcaatccagccctgggccagcagcagcagcagcagcaacatcaagctggggcaggcact
ctagcaggcccctcagctggcttcttccctgggaatcttgctctccgaggcctgggtgct
gatgcaaggctcttacaggagcggcaactccagctgcagcagcagaggatgcagctgtct
cagaagctacagcagcagcagcagcaacagcaccttttgggacaggtagccctgcagcag
cagcaacagcagcagcagcagcaaggcctgggaccaaagccccagggactcctgcctcct
ggcagtcatcagggcctcttggtccagcagctgtccccccagccaaccccagggccccaa
ggcatgctgggccctgcccaggtagcagtgctgcagcaacagcagcagcaggtacaccct
ggggggctgggtccccaaggtccccacagacaagtactccttgcccaacctcgaatgctg
gggtctcctcaactggcccagcaagcacaaggcctaatggcccaccgacttgttatggcc
cagcaacaacagcaacaacagcagcagcagcagcagcagcaacagcagcagcagcagcag
caacagcagcagcaagccctggctggtctctcccatctccagcaaggattgatgcctcct
agtgggcagcccaagttaggcacccagtctatggggacacaacagcagcagcagctgggg
ctcctgaaccagggtcgaactttattgcctccccagcagcaacaacagcaacaattgttg
ccatctccatccagctcccttacccagcagcagcagcagcagcagcagcagcagcagcag
cagcagcaggtggccctgggtcctggcttgcctgccaaacctctccagcactttcccagc
catggagccttaggcccaacccttttgctgagcaaggggttgccctcaggcttaccaggc
aaggagcaagctggggcagagacagtgctagtacctgagggcactgaagccccctcagtg
cacctaggaggaccgttggcattgggtgccccaacagaaaccctgcccccagagccagtg
gaggtgaagccctctatccctggggactctcacctcctcctctcccaaccccaacctcat
actcagatgaactccctgcagttacaggcacctctgagactcccagggcagcagcagcag
cagcagcagcaacagcaagtcagcttactccatccagcaggcagtacaagtcatgggcaa
atgactggtgggcaacccccagaagttacttccatgtcccacctgctgacccagcccctt
agttctgtaggggagcggccatctgggctggatcgacccttgaaagggagcccaaggcca
ccgcctcccaagccaagccctctaccccaccctgggcagggcctacctgggcattcagga
atgcccacagtggggcagcttcgggcccagcttcaaggtgtcctggctaagaacccacag
cttcggcacctgagccctcaacagcaacagcagctgcaggcccttcttgttcagaggcaa
ctgcagcaaggccaggtgctaagacaaacagtgccctatctggagcctgggacccagtct
tcttccttgcaaggcctcctaggtcgccagccccaacctgggggcttcctgggagctcca
tcagggcctctccaagagctaggggcagtgccccgacctcagggcccttcccgactctcc
acctcacaaggagccatatcttcagggtcaacccttggctttgcacagccccctcctttg
ccatccagccctcaagagccaaagagaccttccccccgattgctgccccctagccctcag
ctttctgctgaggttcagctcactcctacccagattgagaacccaaagccccaagaatct
tccttggagttaccttcaggggacattccacccccctcatctgctgcctctcagcttcca
gacactttctttgccaagggaccgggaccttgggaaaccccggacaacctggctgaggcc
cataagactgagcagaacaacatgggacatggagaggtgcagcaggtgaatggacaggaa
atgccggagccaccctgcctcatgatcaagcaggagcctcgagaggagccttgtgccatg
ggggcccagttgataaaacgggagactaatggagagcctatgggcacaccaggcaccagc
aaccacctcttactggcaagcagccgctcagaggctgggcacctgctcttgcagaagctg
cttcgggcaaagaatgtacagcttggcacagggcatggacccgaggggctccgagcagag
atcaatgggcacattgacagcaagctggctggtttggagcagaagcttcagggcactcca
gtcagcaaggaggatgttgcagccaagaaaccactcacccccaaacccaagagggtacag
aaggcaggggacaggatagcaagctcccgaaagaagctccggaaggaagatggggtgaaa
gccaatgaggccctgttgaaacaactaaagcaggaactgtccttgctgccactttcggaa
cccaacatcaccaacaacttcagcctttttgccccctttggcagtggctgcctcatcaat
gggcggaaccagctgaggggggcatttgggagcggggcactacccactggccctgactac
tattcccagcttcttacaaagaataacctgagtaacccgcctacgccaccttcctcactg
ccacctaccccacccccatcagtacagcagaaattggtgaatggggtcactccttctgaa
gaccttggggaacaacaaaaagatgcagcccctgcccgagaatctgaagggggagcaagg
gaagcccctgaagtgaagagtttggacctgctggcagcacttcccacacctcctcacaac
cagactgaggatgtcaggatggagagtgatgaggagagtgactcccctgacagcatcgtt
ccagcttcttcacctgagagtattctaggggaggaggcacctagatttccccaactggta
tcaggccagcaggagcaggaggatagggccctctccccagtcattcccatcatcccccgg
gccagcatcccagtcttcccagatgccaagccctatgggactctggaagtagaaccaaca
ggaaagctttctgccaccacctgggaaaagggcaaagggagtgaagtgtccgtcatgctg
actgtctctgctgcagcagccaagaatctgaatggggtcatggtggctgtggcagagctg
ttgagcatgaagattcccagctcctatgaggtgctgttcccagagagccctgcccgctca
gcgggtgctgagcccaagaagggggaagtggaagggcctggtggtaaagagaaaagcctt
gggggaaagcccacggagagtggcagtgactggctgaaacagtttgatgcagtgctgcca
ggctacaccctcaagagccagctggacatcttgagccttctcaagcaggaaagtcctgtc
ccagagctgcccacccaacactgctacatccacaacgtctccaacctggatgtccgtcag
ctctctgccccgccccctgaagagccttccccacccccttcaccctcagctccttccccc
accagccctccagccgaaccttcggctccgtcacctccacccctggttccctcacctccg
atgcctgaggcggctcgccccaagcccagagcacggccccctgaagagggtgaggattct
cgacctccccggctaaagaaatggaaagggcttcgctggaaacggttacgcctgctgctg
acgatccagaagggcagtgggcgacgggagggtgaacgggaggtagctgaattcatggag
caattgggcacagccctccgacctgacaaagtgccccgtgaccttcggcgctgctgcttc
tgccatgaagagggtgatggcgctaccgacgggcctgcccggctcctcaacctggatcta
gacttgtgggttcatctcaactgtgccctgtggtccacggaggtctatgaaactcagggg
ggggccctgatgaatgttgagggggccctgcaccgggggcttctgaccaagtgctcactg
tgccagcgtacgggagccaccaacagctgtaacagactgcgctgtcccagtgtctaccac
tttgcctgtgccatccgggccaagtgcatgttcttcaaggataagactatgctgtgcccc
ctgcacaagctgaaagggccctgtgagcaggagctgagctcttttgccgtctttcgccgt
gtctacatcgagcgggatgaggtaaagcagatagccagcatcatccaacgtggtgagcgg
ctccacatgttccgggtagggggcctggtgttccacgccatcgggcagcttctgccccac
cagatggccgacttccacagtgctacagccctctaccctgttggctacgaggccactcgc
atctactggagcttacgcaccaacaaccgccgatgctgttaccgctgctccatcattgag
aacaatgggcggcccgagttcatcatcaaggtcatggaacagggcttggaggacctggtc
ttcactgatgcatcccctcaggctgtgtggaatcgtatcattgagccagtggctgccatg
cgcaaggaagccgacatgcttcggttattcccggagtatcttaagggagaggagctcttt
gggttgacagtacatgctgtcctacggattgcagaatcgctgcctggggtggaaagctgt
cacaactacttgtttcgatatggacggcacccactgatggaattgccacttatgatcaac
cctactggctgtgcccgctctgagcccaaaattctcactcactacaaacggcctcacacc
ctcaacagcaccagcatgtccaaggcttaccagagcaccttcacaggtgagaccaacacc
ccgtacagcaaacagtttgtgcactccaagtcatcccagtatcggcggctgcgcactgag
tggaagaacaacgtctacctggctcgatctcgaattcagggcctggggctgtatgctgcc
aaggacctggagaagcacacaatggtcatcgagtacattggcaccatcatccgcaatgag
gtggccaaccgtcgtgagaagatctacgaggagcagaatcgaggtatctatatgtttcgg
ataaacaatgagcatgtgattgatgccacactgactggagggcctgccaggtacataaac
cattcatgtgcccccaactgtgtggcagaggttgtgacctttgataaagaggataagatc
attatcatctctagccggcgcatccccaaaggagaggagctgacctatgactatcagttt
gactttgaggatgatcagcacaaaatcccctgccattgtggagcctggaactgccggaag
tggatgaactaa

DBGET integrated database retrieval system