KEGG   Sarcophilus harrisii (Tasmanian devil): 100928595Help
Entry
100928595         CDS       T02286                                 

Gene name
USP20
Definition
(RefSeq) ubiquitin specific peptidase 20
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100928595 (USP20)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100928595 (USP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 908 aa AA seqDB search
MGDSREFCPHLDSIGEVTKEDLLLKSKGTCQSCGAGGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRVWCYACEKEVFLDQRLAAPPPAPPSKFSEQETPLPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGLKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVAAAGRDSDSSDSEEKREGDRSPSXDEFLSCDSSSDRGEGDGQGRGVGMG
STLAETELLIQDEAGRGISEKERMKDRKFSWGHQRTSSEQVDEDADVDTTMTAIDDRPTE
ALPSPRSTSPCRTPEPDNDAYMRCSSRPCSPVHHEAHSKLSSSPPRSSPVRVGPSYVLKK
AQVLAAGKKKKELRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLA
KLHSAIYQNVPAKSGTCGDSYTSQGWIAFIMEYIRRFVVSCIPSWFWGPVVTLEDCLAAF
FAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFS
LEGLDLQPFLAKECVSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTE
VHETVVQNAEAYVLFYRKSSEEAVRERQHVVSLATMKEPSLLQFYISREWLNKFNTFAEP
GPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEYLYNRFGGGPAVNHLYVCSVCQVE
IEALAKRRRIEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNDPPGPIDNS
KIALIKGGGHIQVKQGADYGQISEETWTYLNTLYGGGPEIAIRQSIAQLQEPENLHGEQK
IEAETRAV
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggagactcccgggaattttgccctcaccttgattctataggtgaggtcaccaaagag
gacttactactgaaatccaagggaacttgccagtcctgtggagcaggaggaccgaacctc
tgggcctgtctccaggttgcttgcccttatgttggatgtggagaatcttttgctgaccat
agcactattcatgcacaggccaaaaagcacaatctgactgtgaacctcaccactttccgt
gtatggtgttatgcttgtgaaaaggaagtcttcttggatcagaggttagcagcaccccca
ccagctccaccatccaagttctcagagcaggaaactcctttgccttctcaccctttgaag
gctgtccctattgcagtagctgatgaaggggaatctgagtctgaggatgatgacttgaaa
cctcgaggcctgactggtttgaaaaaccttgggaattcttgctacatgaatgcagccctc
caggcactctccaactgtccccctttgacccagttcttcttggagtgtggaggattggtg
agaactgacaagaaaccagccctatgcaaaagttaccagaagcttgtctcagaggtctgg
cacaagaagcggcccagctatgtggtacctaccagtctctcccatggaatcaagttggtc
aatcccatgtttcgaggttatgcacagcaggacacccaagagttcctccgctgtttgatg
gaccaactacacgaagagctcaaggagccagtggcagctgctgggagggactcagactcc
agcgactcagaagagaagcgcgagggcgaccggagcccttcataggatgaattcctctcc
tgtgactccagcagtgatcggggtgagggggatgggcaaggcaggggggtgggcatgggc
agcaccctggcagagactgagttgctgatccaggatgaagcgggcagggggatttcagag
aaggagaggatgaaggacagaaaattctcctggggccaccagcgaactagctctgagcaa
gttgatgaggacgcagatgttgataccaccatgaccgccatcgatgatcgccccacggaa
gcccttccctctccacgttccaccagcccatgtaggacaccagagccagataacgatgcc
tatatgcgctgctcctcgcgcccttgcagccccgtccaccacgaggcacactccaagctg
tcgagcagcccgcctcgctccagccctgtgagagtgggaccttcctatgtgctcaaaaaa
gctcaggtgttggctgctgggaaaaagaagaaagagcttcgctaccggagtgtcatctca
gacatcttcgacggctccatactcagcctggtgcagtgcctcacctgtgacagagtatcc
accaccgtagagacatttcaagatctctcgttgcccatcccagggaaggaggacctagcc
aagctgcactcagccatctaccagaatgtgccagccaagtcagggacatgtggggatagt
tacacatcacagggctggattgccttcatcatggagtatatccgaaggtttgtggtatct
tgcatccccagctggttttggggtcctgttgtcactttggaagactgtcttgctgctttt
tttgctgctgatgagttgaagggggacaatatgtatagctgtgaacgatgtaaaaaatta
cgaaatggagtgaaatattgtaaagttcttcggttgcctgagattctatgcattcattta
aaacgttttcggcatgaagtgatgtattcattcaaaatcaatagccacgtctccttctcc
ttggaaggtcttgatctacaacccttccttgccaaggaatgtgtctcccagatcaccacc
tatgaccttttatctgtcatctgccatcatggcacagcaggcagtgggcactacatcgcc
tactgtcagaatgtcataaatggccagtggtatgagtttgatgatcaatatgtcacagaa
gtccatgaaacagtggtccaaaatgcagaggcttatgtcctattttataggaagagcagt
gaggaggcagtgcgagaacgtcagcatgtagtatccttggccactatgaaggagcccagc
ttgctccagttctacatttcccgcgagtggctcaataagttcaacacatttgctgaacca
ggacccattacaaaccatacgttcctctgttcccatggaggaattccacccaataaatac
cattacattgatgatcttgtggtgatcctgccccagaatgtatgggaatatctctacaac
aggtttggtggtggccctgctgtgaatcatctctatgtgtgctcagtctgccaggtagag
atagaagccctggccaaacgaaggcggattgaaatcgacaccttcattaagctaaacaaa
gcatttcaagcagaagaatcccccagtgtcatctattgcatcagtatgcagtggttccgg
gaatgggaggcctttgttaaggggaaagacaatgatcctcctggacccattgacaacagc
aagatagcactgatcaaaggtggaggtcacatccaggtgaagcagggagctgactacgga
cagatttcagaggagacctggacttatctgaataccctttatggaggtggtcctgagatt
gcaatccgacagagcattgcccagttgcaggaaccagagaacctgcatggggaacagaag
attgaggcagagacccgggctgtgtga

DBGET integrated database retrieval system