KEGG   Sarcophilus harrisii (Tasmanian devil): 100928729Help
Entry
100928729         CDS       T02286                                 

Gene name
MAPK12
Definition
mitogen-activated protein kinase 12
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100928729 (MAPK12)
   04010 MAPK signaling pathway
    100928729 (MAPK12)
   04370 VEGF signaling pathway
    100928729 (MAPK12)
   04668 TNF signaling pathway
    100928729 (MAPK12)
   04068 FoxO signaling pathway
    100928729 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100928729 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100928729 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100928729 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100928729 (MAPK12)
   04660 T cell receptor signaling pathway
    100928729 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100928729 (MAPK12)
   04670 Leukocyte transendothelial migration
    100928729 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    100928729 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100928729 (MAPK12)
   04917 Prolactin signaling pathway
    100928729 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100928729 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    100928729 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100928729 (MAPK12)
   04722 Neurotrophin signaling pathway
    100928729 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100928729 (MAPK12)
  Development
   04380 Osteoclast differentiation
    100928729 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100928729 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100928729 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    100928729 (MAPK12)
   05133 Pertussis
    100928729 (MAPK12)
   05152 Tuberculosis
    100928729 (MAPK12)
   05164 Influenza A
    100928729 (MAPK12)
   05160 Hepatitis C
    100928729 (MAPK12)
   05169 Epstein-Barr virus infection
    100928729 (MAPK12)
   05145 Toxoplasmosis
    100928729 (MAPK12)
   05140 Leishmaniasis
    100928729 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    100928729 (MAPK12)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928729 (MAPK12)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100928729 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 360 aa AA seqDB search
MLFTDVEDELEKAKTGASSAIDSRTGTKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE
NVIGLLDVFTPDDTLDDFTDLXVAVDGGEAPLCECCEAWGHLQQLCPDSADPKSRSPPPR
PPNPVASDFAEDPLTIPRYIHAAGIVHRDLKPGNLAVNEDCELKILDFGLARQADSEMTG
YVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGSDHLDQLMEIMKVTGT
PPPEFVQRLQSQDAKNYMESLPELEKKDFASVLKNATPLAVNLLEKMLVLDSEKRVTAAE
ALTHPYFETVHESEEEPQAQLYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRLLDSKETSL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctttttacagatgtggaagatgaactggagaaggcaaaaactggagcaagctcggcc
attgacagcaggaccggcaccaaggtggccatcaagaagctgtaccgtcccttccagtcg
gagctgttcgccaagcgcgcataccgggagctgcggctgctcaaacacatgcggcacgag
aacgtcatcggcctcctggatgtcttcaccccggacgacacactggacgacttcacagac
ttgtgagtggctgtggatgggggggaggctcctctctgcgagtgctgcgaggcctgggga
cacctccagcagctctgcccagactcagcagatccaaagtcaaggtcgccacctccccgg
cccccaaatcccgtcgcttctgactttgctgaggaccctctcaccatcccccggtacatc
cacgctgccggcatcgtccacagggatcttaagcccggcaacctggctgtgaacgaggac
tgtgaactgaagattctggacttcggtctggccaggcaggcggacagcgagatgaccggc
tacgtggtgaccaggtggtacagggcgcctgaggtcatcctgaactggatgcgttacacg
cagacagtggatatctggtccgtgggctgcatcatggccgagatgatcaccggcaagatc
ctgttcaaagggagtgaccacctggatcagctgatggagatcatgaaggtgaccgggacg
cctcccccggagtttgtgcagcggctccagagtcaggacgccaagaactacatggagagt
ctccctgagctggagaagaaggactttgcttccgtcctgaagaacgcgacccccttggct
gtgaacctgctggagaagatgctggtgctggactccgagaagcgagtgacggccgcggag
gcgctgacccacccctacttcgagacggtgcacgagtctgaggaggagccccaggcccag
ctctacgatgactccttcgatgatgtggaccggacgctggaggagtggaaacgagtcaca
tacaaagaagtcctcagctttaagcctcctcggcttctggactcaaaggagacatccctg
tga

DBGET integrated database retrieval system