KEGG   Sarcophilus harrisii (Tasmanian devil): 100928746Help
Entry
100928746         CDS       T02286                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100928746 (PRKG1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100928746 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100928746 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100928746 (PRKG1)
  Nervous system
   04730 Long-term depression
    100928746 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100928746 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100928746 (PRKG1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100928746 (PRKG1)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100928746 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 596 aa AA seqDB search
MDRLRHPGRLVFQFHDVWHPDNKQELEFEENLLTPNSTLFQYGIMTPFFRTHEYKLNRPS
SNNPQKAVLKSILLKSSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKE
GDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAID
RQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGA
RGDTFFIISKGTVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTC
LVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEGAFFANLKLSDFNIIDTLGVGGFGR
VELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKY
LYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD
HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLT
GRWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccttcgacacccaggcagactcgtgtttcagtttcatgatgtatggcaccca
gacaataagcaagagctagagtttgaggagaatcttttgactccaaattcaacacttttc
cagtacggcattatgactccattctttaggacccatgaatataaactgaatcgtccttct
tccaacaacccccagaaagcagttctaaaaagcatcctcttgaaatcgtccaaggatctt
atcaaagaagccattcttgataatgacttcatgaagaacctagagctgtcccagatccag
gaaattgtggattgtatgtatcctgtggagtatggcaaagacagctgcatcatcaaagaa
ggcgatgtgggctccctagtgtacgtcatggaagatggaaaggttgaagttaccaaagag
ggggtgaagctgtgcactatgggaccaggcaaagtctttggagaactcgcaattctatac
aactgtacccgcacagctaccgtcaaaactcttgtaaatgtgaaactctgggccattgat
cgacaatgttttcagacaataatgatgaggacaggtctcatcaagcacacggaatatatg
gagtttttgaaaagtgttcccacattccagagcctccctgaagagattctaagcaagttg
gctgatgttctggaagagacacactatgagaatggggaatatatcatcaggcaaggggcc
cgaggggataccttcttcatcatcagcaaaggaacggtaaatgtcactcgagaagattct
ccaagtgaagacccaatctttcttcgcactttagggaaaggagattggtttggagaaaag
gccctccagggggaagatgtgaggactgccaatgtcatcgctgcagaagccgtgacctgc
ctggtgatcgacagagactccttcaagcatttgatcggaggcttggatgatgtttctaac
aaggcctatgaagatgcggaggcaaaggcaaaatatgaagctgaaggggcattcttcgcc
aacctgaagctatccgatttcaacatcatcgacacgctgggagttggaggttttggacga
gtggagctggtccagttgaaaagtgaagaatcaaaaacatttgctatgaaaattctcaag
aagcgccacattgtggacacgagacagcaggagcacatccgttctgaaaagcagatcatg
caaggggctcattcagatttcattgttagactatatcggaccttcaaggacagcaaatat
ttgtatatgttaatggaagcctgcctaggtggagagctttggacgattctcagggacaga
ggttcatttgaagattcgacaaccagattttatactgcgtgtgtggtagaagcgtttgcc
tatctgcattccaaaggaatcatttacagggacctcaagccagaaaacctcattcttgac
caccgaggttacgccaaactggttgattttggctttgcaaagaaaataggatttggaaag
aaaacatggactttttgtgggaccccagagtacgtagctcctgagatcatcctgaacaaa
ggtcatgacatttcggcggactactggtcgctaggaatcttaatgtatgaactcctgact
ggcagatggtttgaaggctttaattgggaaggcttacgaaaaggtaccttgacaccgcct
ataataccaagtgttgcatcccccacagatacgagcaactttgacagtttccctgaggac
aatgatgagccaccgccagatgacaactcgggatgggacatagacttttag

DBGET integrated database retrieval system