KEGG   Sarcophilus harrisii (Tasmanian devil): 100928839Help
Entry
100928839         CDS       T02286                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100928839
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100928839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 300 aa AA seqDB search
MGASLLIAILVIGASILLLSLRNLGSPKKKELITLLDPNTKYPLPLIEKQELSHDTKMFR
FGLPTSDHVLGLPIGQHVYLSAKVNGNLVIRAYTPVSSDEVKGYVDLVVKIYYKNVHPKF
PEGGKMSQYLDNMKIGDTIDFRGPNGLLVYNGSGKLSIRPDKKSEPKMKFAKNLGMIAGG
TGITPMLQLIRHITKDPADGTKCSLIFANQTEEDILLRAELEEVVKSHPNQFRLWYTLDR
PPNDWKYSSGFINADMIKDHLPPPGDDTLILMCGPPPMIQFACQPNLEKLGYAQDKTFAY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttcgctcttgattgcgatcttggtaattggtgcatcaatattactgctgtct
ttaaggaacttgggatctccgaagaagaaagaacttatcacgttactggatccaaataca
aaatatccactgcccctgattgaaaaacaggaactcagccatgacaccaagatgttccgg
tttggacttcctacatcagaccacgttttagggctccctataggtcaacatgtttatctc
tctgccaaagtcaatggcaatctagtgatccgggcttatactcctgtttctagtgatgaa
gtaaaaggctatgtggaccttgttgttaagatttactacaaaaatgtgcaccctaagttt
cctgaggggggaaagatgtctcagtacctggataacatgaagataggggataccattgat
ttccgagggccaaacgggctcctggtttataatggatcaggtaagctgtccatcagacca
gataagaagagtgaaccaaagatgaagtttgccaagaatttgggaatgattgctggtggg
acaggaataacaccaatgctacagctgattcggcacattaccaaggatcctgcagatggt
accaagtgctcccttatctttgctaatcagactgaagaagatatcctactgagagcagaa
ctagaggaagtggtgaagagtcatccgaaccagtttagactgtggtacactctggacagg
cctcctaatgattggaagtatagctctggatttattaatgcagacatgatcaaggaccat
ctaccaccaccaggagatgataccctcattttgatgtgtggtcctcctccaatgatccag
tttgcctgtcaacccaacctggaaaaactgggctatgctcaagacaagacttttgcatac
tga

DBGET integrated database retrieval system