KEGG   Sarcophilus harrisii (Tasmanian devil): 100928896Help
Entry
100928896         CDS       T02286                                 

Gene name
THBS3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100928896 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100928896 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100928896 (THBS3)
  Cell communication
   04510 Focal adhesion
    100928896 (THBS3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100928896 (THBS3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100928896 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100928896 (THBS3)
  Exosomal proteins of bladder cancer cells
   100928896 (THBS3)
Heparan sulfate/heparin binding proteins [BR:shr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100928896 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 957 aa AA seqDB search
METQELRGPLALLLLCSFASASQDLQVIDLLTMGESRQMVAMAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRRDNTRWLEASIVGKINKVLVRYQREDGKVHAVNLQQVGLADG
RTHTALLRLRGPSRPNPALQLYVDCKLGDQHAGLPPLAPIPPAEVDGLEVRTGQKAYMRM
QGFIESMKMILGGSMARVGALSECPFQGDEESIHNAVTGVLHSILGEQTKALVTQLTLFN
QILVELREDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYR
CGPCPPGLQGNGSHCADINECAHADPCFPGSKCINTMPGFHCETCPQGYKGTQVSGVGID
YARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRSGFLGNQSQGCLPARACQ
SPAHNPCHVHAHCLFERNGAVSCSCNIGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCK
QDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDAC
DNCPNVPNNDQKDTDSNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACD
SCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGQGDEC
DGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVADPLDVCPESA
EVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEG
TFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVKSVS
GPGEHLRNALWHTGHTPEQVRLLWTDPRNVGWQDKTSYRWQLLHRPQVGYIRVKLYEGPQ
LVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcgggggcccttggctcttctcctcctctgctcctttgcctct
gctagtcaggaccttcaggtgattgacttgctgactatgggtgagtctcggcagatggtg
gccatggcagaaaaaatccggacagctctactgacagctggggatatctacctcctgtcc
accttccgactgcctcccaaacagggtggtgttctctttggcctctactctcgccgtgac
aacactcgttggctggaagcctccatcgtgggcaagatcaacaaagtattggttcggtac
cagcgggaagatgggaaagtacacgcagtgaacctacagcaagtgggcctagcagatgga
cgtacccacactgccctgttgcgcctccgtggtccttcccgaccgaatcctgctctacag
ctctatgtggactgtaagctaggtgaccagcatgctgggctccccccattggcccctatc
cctcctgctgaagtagatggactagaggttcggactggccagaaggcttatatgagaatg
cagggcttcatagagtccatgaaaatgattctggggggatcaatggcccgagttggggca
ctgagtgaatgtccattccaaggagatgaggaatccattcataacgcagtgaccggagta
cttcactctattctaggtgaacagacaaaggcactagtcacccaacttacccttttcaat
cagatcctggtagagcttcgagaggacatccgagaccaggttaaggagatgtccttgatc
agaaacaccattatggagtgtcaggtgtgcggcttccacgagcaacgttcccactgtagc
cccagtccctgtttccgtggtgtggactgcatggaagtctacgagtacccaggctacaga
tgtgggccttgcccccctggtcttcagggcaatggcagtcactgtgctgacataaatgag
tgtgcccatgcagatccctgctttccaggctccaaatgtatcaacaccatgccaggattt
cactgtgagacctgtcctcaagggtacaaagggacccaggtgtctggtgtgggtatcgac
tatgctcgtgccagcaaacaggtctgcaatgatgtggatgaatgcaatgatggcaacaat
ggtggctgtgaccccaattctatctgcacaaatactgtgggttccttcaagtgtggtcca
tgccgttcaggtttcctgggtaaccagagccagggttgtcttccagcccgggcctgtcaa
agcccagcacacaacccctgccatgtccatgctcactgtctgttcgagcgaaatggtgct
gtgtcttgctcgtgcaacataggatgggcagggaatgggaatgtctgtggccccgacact
gacattgatggctatccagaccaggccctgccctgcatggataacaacaagcattgtaaa
caggacaattgcctcttgacacccaattctgggcaagaggatgccgacaatgatggagtg
ggtgaccagtgtgatgatgatgctgatggcgatgggatcaagaatgtggaggataactgc
cggctgtttcccaacaaagaccagcagaactcagacacagattcatttggtgacgcctgt
gacaactgtcccaacgtacctaacaatgaccagaaggacacagacagcaacggggaaggg
gacgcttgtgacaacgatgtggatggggatggaatccctaacgggctggacaactgccca
aaggtccctaaccccctgcagacggatcgggatgaggatggggtgggggatgcttgtgat
agctgcccggaaatgagtaatcctacgcagacagatgcagacagtgacctggtaggggac
gtctgtgacacgaacgaagacagtgatggtgatggacatcaggacaccaaggacaactgc
ccccagctacccaacagctcccagcttgattcagacaatgatgggcagggtgatgagtgt
gatggagatgatgacaatgatggcatcccagactatgtgccccctggtcctgacaactgt
aggctggtgcctaaccccaaccagaaggactcagatggcaatggtgtgggggacgtgtgt
gaggatgactttgacaacgatgcggtggctgatccccttgatgtgtgtcctgagagtgct
gaagtaacactaactgacttccgggcttatcagactgtagtcctggatcctgagggggat
gcccagattgacccaaattgggttgtactcaaccagggtatggaaattgttcagactatg
aacagtgaccctggcctggctgtggggtacacagccttcaatggtgtagacttcgagggc
accttccatgtgaacacagtgacagatgatgattacgctggttttctcttcagctaccaa
gatagtggccgattctacgtagtcatgtggaaacagacagagcaaacttactggcaggca
acacccttccgtgctgtggcccaacctggcctgcagctcaaggcagtaaagtcagtgtct
ggtccaggcgagcacctccgaaatgccctgtggcacacaggccatacaccagagcaagtt
cgcctactgtggacagatccacgaaatgtgggctggcaggacaagacttcgtaccgctgg
cagctgcttcacaggcctcaagttggatatatccgggtgaaactctatgagggtccccag
ctggtagcagattccggggtgatcattgatacatccatgcgggggggtcgcctgggtgtc
ttctgcttctcccaagaaaacatcatctggtctaatctacagtatcggtgcaatgacaca
gtgcctgaggattttgaaccattcaggaggcagttgcttcagggacgggtgtga

DBGET integrated database retrieval system