KEGG   Sarcophilus harrisii (Tasmanian devil): 100928896Help
Entry
100928896         CDS       T02286                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin-3 isoform X1
  KO
K04659  
thrombospondin 2/3/4/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100928896 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100928896 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100928896 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100928896 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100928896 (THBS3)
   05144 Malaria
    100928896 (THBS3)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100928896 (THBS3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100928896 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100928896 (THBS3)
  Exosomal proteins of bladder cancer cells
   100928896 (THBS3)
Cell adhesion molecules and their ligands [BR:shr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100928896 (THBS3)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100928896 (THBS3)
   VNR
     100928896 (THBS3)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100928896 (THBS3)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100928896 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
4
AA seq 980 aa AA seqDB search
MKTGRKCQDVGGRAPGVVSRLIGMETQELRGPLALLLLCSFASASQDLQVIDLLTMGESR
QMVAMAEKIRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRRDNTRWLEASIVGKINKVL
VRYQREDGKVHAVNLQQVGLADGRTHTALLRLRGPSRPNPALQLYVDCKLGDQHAGLPPL
APIPPAEVDGLEVRTGQKAYMRMQGFIESMKMILGGSMARVGALSECPFQGDEESIHNAV
TGVLHSILGEQTKALVTQLTLFNQILVELREDIRDQVKEMSLIRNTIMECQVCGFHEQRS
HCSPSPCFRGVDCMEVYEYPGYRCGPCPPGLQGNGSHCADINECAHADPCFPGSKCINTM
PGFHCETCPQGYKGTQVSGVGIDYARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFK
CGPCRSGFLGNQSQGCLPARACQSPAHNPCHVHAHCLFERNGAVSCSCNIGWAGNGNVCG
PDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVE
DNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDSNGEGDACDNDVDGDGIPNGLD
NCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTK
DNCPQLPNSSQLDSDNDGQGDECDGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVG
DVCEDDFDNDAVADPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIV
QTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTY
WQATPFRAVAQPGLQLKAVKSVSGPGEHLRNALWHTGHTPEQVRLLWTDPRNVGWQDKTS
YRWQLLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRC
NDTVPEDFEPFRRQLLQGRV
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgggagaaagtgccaagatgttggcgggagagctcctggggttgtgagccgg
ctcatcggcatggagacgcaggaacttcgggggcccttggctcttctcctcctctgctcc
tttgcctctgctagtcaggaccttcaggtgattgacttgctgactatgggtgagtctcgg
cagatggtggccatggcagaaaaaatccggacagctctactgacagctggggatatctac
ctcctgtccaccttccgactgcctcccaaacagggtggtgttctctttggcctctactct
cgccgtgacaacactcgttggctggaagcctccatcgtgggcaagatcaacaaagtattg
gttcggtaccagcgggaagatgggaaagtacacgcagtgaacctacagcaagtgggccta
gcagatggacgtacccacactgccctgttgcgcctccgtggtccttcccgaccgaatcct
gctctacagctctatgtggactgtaagctaggtgaccagcatgctgggctccccccattg
gcccctatccctcctgctgaagtagatggactagaggttcggactggccagaaggcttat
atgagaatgcagggcttcatagagtccatgaaaatgattctggggggatcaatggcccga
gttggggcactgagtgaatgtccattccaaggagatgaggaatccattcataacgcagtg
accggagtacttcactctattctaggtgaacagacaaaggcactagtcacccaacttacc
cttttcaatcagatcctggtagagcttcgagaggacatccgagaccaggttaaggagatg
tccttgatcagaaacaccattatggagtgtcaggtgtgcggcttccacgagcaacgttcc
cactgtagccccagtccctgtttccgtggtgtggactgcatggaagtctacgagtaccca
ggctacagatgtgggccttgcccccctggtcttcagggcaatggcagtcactgtgctgac
ataaatgagtgtgcccatgcagatccctgctttccaggctccaaatgtatcaacaccatg
ccaggatttcactgtgagacctgtcctcaagggtacaaagggacccaggtgtctggtgtg
ggtatcgactatgctcgtgccagcaaacaggtctgcaatgatgtggatgaatgcaatgat
ggcaacaatggtggctgtgaccccaattctatctgcacaaatactgtgggttccttcaag
tgtggtccatgccgttcaggtttcctgggtaaccagagccagggttgtcttccagcccgg
gcctgtcaaagcccagcacacaacccctgccatgtccatgctcactgtctgttcgagcga
aatggtgctgtgtcttgctcgtgcaacataggatgggcagggaatgggaatgtctgtggc
cccgacactgacattgatggctatccagaccaggccctgccctgcatggataacaacaag
cattgtaaacaggacaattgcctcttgacacccaattctgggcaagaggatgccgacaat
gatggagtgggtgaccagtgtgatgatgatgctgatggcgatgggatcaagaatgtggag
gataactgccggctgtttcccaacaaagaccagcagaactcagacacagattcatttggt
gacgcctgtgacaactgtcccaacgtacctaacaatgaccagaaggacacagacagcaac
ggggaaggggacgcttgtgacaacgatgtggatggggatggaatccctaacgggctggac
aactgcccaaaggtccctaaccccctgcagacggatcgggatgaggatggggtgggggat
gcttgtgatagctgcccggaaatgagtaatcctacgcagacagatgcagacagtgacctg
gtaggggacgtctgtgacacgaacgaagacagtgatggtgatggacatcaggacaccaag
gacaactgcccccagctacccaacagctcccagcttgattcagacaatgatgggcagggt
gatgagtgtgatggagatgatgacaatgatggcatcccagactatgtgccccctggtcct
gacaactgtaggctggtgcctaaccccaaccagaaggactcagatggcaatggtgtgggg
gacgtgtgtgaggatgactttgacaacgatgcggtggctgatccccttgatgtgtgtcct
gagagtgctgaagtaacactaactgacttccgggcttatcagactgtagtcctggatcct
gagggggatgcccagattgacccaaattgggttgtactcaaccagggtatggaaattgtt
cagactatgaacagtgaccctggcctggctgtggggtacacagccttcaatggtgtagac
ttcgagggcaccttccatgtgaacacagtgacagatgatgattacgctggttttctcttc
agctaccaagatagtggccgattctacgtagtcatgtggaaacagacagagcaaacttac
tggcaggcaacacccttccgtgctgtggcccaacctggcctgcagctcaaggcagtaaag
tcagtgtctggtccaggcgagcacctccgaaatgccctgtggcacacaggccatacacca
gagcaagttcgcctactgtggacagatccacgaaatgtgggctggcaggacaagacttcg
taccgctggcagctgcttcacaggcctcaagttggatatatccgggtgaaactctatgag
ggtccccagctggtagcagattccggggtgatcattgatacatccatgcgggggggtcgc
ctgggtgtcttctgcttctcccaagaaaacatcatctggtctaatctacagtatcggtgc
aatgacacagtgcctgaggattttgaaccattcaggaggcagttgcttcagggacgggtg
tga

DBGET integrated database retrieval system