KEGG   Sarcophilus harrisii (Tasmanian devil): 100928928Help
Entry
100928928         CDS       T02286                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:shr00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 441 aa AA seqDB search
MRMGGSRADELRPERSRAFTFWGLSPGLALVLALVGVSGVTALDNGLALTPTMGWLHWER
FTCNVDCMEDPENCISEQLFMQMAEVMVSEGWKDVGYEYVCIDDCWLASQRDKDGRLQAD
PKRFPRGIRHLANYVHSKGLKLGIYQDVGTLTCAGYPGSFGYYDIDAETFADWGVDLLKF
DGCYAKDVKSLVEGYKYMSYALNKTGRSILYSCEWPLYMRPHQQPNYTEIRQYCNHWRNY
GDIFDSWSSVKNILAWTASHQKSLVPAAGPGGWNDPDMLVIGNFGLSWDQQITQMALWAI
MAAPLFMSNDLRNISPQSKALLQNKDVIAINQDPLGKQGYQLRKDEDFEVWQRPLSDLAW
AVAVLNQREIGGPGTYTISTTALGEGLGCAPACLITQILPVKKELGLYEWTSQLKVRVNP
TGTVLLKLQTFQQDKFPKMSP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgggcggatcgagggctgacgagctccggcccgagcggagccgggcctttacc
ttctggggcttgagcccgggtctggccctggtcctggctctggtgggcgtgtccggggtc
actgccctggacaacgggctggctctgaccccgaccatgggctggctgcactgggagcgc
ttcacgtgtaatgtggactgcatggaggatccggagaactgcatcagtgaacagctcttc
atgcagatggctgaagtcatggtatcagaaggctggaaggatgtgggctacgagtacgtc
tgcatcgatgattgttggttggcctcccaacgagacaaggacggtaggctccaggcggat
cccaagcgcttcccaagaggaatccgtcacctggcaaactatgtacattccaaaggactg
aagttagggatttaccaagatgtgggaactctcacctgtgctggatacccaggcagcttt
ggctactatgatatcgatgctgaaacctttgctgactggggggtggacttgctgaaattt
gacggctgttacgctaaagatgtgaaaagtttggtagaaggctataagtacatgtcctat
gccctcaacaaaactggcagaagcattctctattcctgtgagtggcctctgtacatgagg
ccccaccagcagcccaattacacggaaattcgacagtactgtaaccactggaggaactat
ggtgatatctttgattcctggagtagtgtgaagaatattctggcctggactgcgagtcat
cagaagagcctcgttcccgccgccgggccggggggctggaatgatcctgacatgttagtg
atcggcaactttggactcagctgggatcaacaaataactcagatggcactctgggctatc
atggcagccccacttttcatgtctaacgacctccgaaacatcagcccccaatccaaggcc
ctgctgcagaataaagatgtgattgcaatcaaccaggatcctctgggcaaacagggctac
cagctcaggaaggatgaggactttgaagtgtggcagcggcccctgtctgatttagcctgg
gccgtggctgtgctgaaccagagagagatcgggggacctgggacttacaccatctccacc
acagccctgggtgaaggactagggtgtgccccagcctgccttatcacccaaatccttcca
gttaaaaaagagctgggtctttatgaatggacatctcagttgaaggttcgagtaaacccc
acaggcactgtcctcttgaagctccagactttccagcaagacaagtttccaaagatgtca
ccctag

DBGET integrated database retrieval system