KEGG   Sarcophilus harrisii (Tasmanian devil): 100928944Help
Entry
100928944         CDS       T02286                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04068  FoxO signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04371  Apelin signaling pathway
shr04530  Tight junction
shr04710  Circadian rhythm
shr04714  Thermogenesis
shr04910  Insulin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04921  Oxytocin signaling pathway
shr04922  Glucagon signaling pathway
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr05410  Hypertrophic cardiomyopathy (HCM)
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100928944 (PRKAA1)
   04068 FoxO signaling pathway
    100928944 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100928944 (PRKAA1)
   04152 AMPK signaling pathway
    100928944 (PRKAA1)
   04150 mTOR signaling pathway
    100928944 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100928944 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    100928944 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100928944 (PRKAA1)
   04922 Glucagon signaling pathway
    100928944 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100928944 (PRKAA1)
   04921 Oxytocin signaling pathway
    100928944 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    100928944 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100928944 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    100928944 (PRKAA1)
   04714 Thermogenesis
    100928944 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100928944 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    100928944 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100928944 (PRKAA1)
   04931 Insulin resistance
    100928944 (PRKAA1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100928944 (PRKAA1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100928944 (PRKAA1)
Membrane trafficking [BR:shr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100928944 (PRKAA1)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100928944 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100928944 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 100928944
NCBI-ProteinID: XP_003759964
Ensembl: ENSSHAG00000014164
UniProt: G3WMJ5
Position
2
AA seq 559 aa AA seqDB search
MRRLSTWRKMAAAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHFSRPHPERVPFLVAETPRSRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDI
MAEVCRSIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTTTPQRSGSVSNYRSCQKNDSDAEAQGRSSDVSLTSSVTSLDSSTVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcagtacctggaggaagatggcggcggcggagaagcagaaacacgacggg
cgagtgaagattggccactacatcctgggggacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaagcatgagttgactgggcacaaagttgctgtgaagatcttaaatcga
cagaaaattcgaagtcttgatgtggtagggaaaattcgcagagaaattcaaaaccttaag
cttttcagacatcctcatatcattaagctgtaccaggtcattagtacaccatctgacatt
ttcatggtgatggaatatgtctctgggggagaactatttgattatatctgtaaaaatggc
aggctggatgagaaagagagtcggcgtttatttcaacaaatcctttctggtgtggattat
tgtcacaggcacatggttgtccatagagacttgaaacctgaaaatgttttgcttgatgca
cacatgaatgcaaaaatagctgattttggtctttcaaatatgatgtcagatggcgaattt
ttaagaacaagctgtggctctcccaactatgctgcaccagaagtaatttcaggaaggtta
tatgcaggtccagaggtagatatttggagcagtggtgttattctttatgctctgttatgt
ggcacccttccatttgatgatgatcatgtgccaactctttttaagaagatatgtgatggg
atcttttatactcctcagtacttgaatccttctgtgattagccttctgaaacatatgctg
caggtggatcccatgaagagagccacaatcaaagatatcagggaacatgagtggtttaaa
caagatcttccaaagtatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaaatttgaatgtacagaggaagaggttctcagc
tgtctgtatagcagaaaccaccaggaccctttggcagttgcttatcacctcataatagat
aataggagaataatgaatgaggccaaagatttctatttagctacaagcccaccagattct
ttcttagatgatcaccatttttctcgtccacatcctgaaagagtgccattcttggttgcg
gaaacaccaaggtcacgccatacattggatgaattaaatcctcaaaaatccaaacaccag
ggtgtaaggagggcaaaatggcatttgggaattcgaagtcaaagtagaccaaatgacatc
atggcagaagtttgtcgctcaattaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgttcgaaggaagaatccagtgacaagcacttattcaaaaatgagtcta
cagttataccaggtggacagtagaacttacttattggatttccgaagcattgatgatgaa
attactgaagccaaatctggaactactactccacaaagatcaggttctgtgagcaattat
cgatcttgccaaaagaatgactcagatgctgaagcccaaggaagatcctcggatgtttcc
cttacctcatcagtgacttcacttgactcttctacagttgacttaaccccaaggccagga
agtcacacaatagagttttttgagatgtgtgcaaatcttattaaaattcttgcacagtaa

DBGET integrated database retrieval system