KEGG   Sarcophilus harrisii (Tasmanian devil): 100928966Help
Entry
100928966         CDS       T02286                                 

Gene name
PRKX
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100928966 (PRKX)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100928966 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 279 aa AA seqDB search
MSIPDVIRLKQEQHVHNEKSVLKEVNHPFLIRLYWTYHDERFLYMLMEYVPGGELFSYLR
NMGRFNNSTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTDFGFAKKLVD
RTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAG
KIDFPRHLDLYVKDLIKKLLVVDRTRRLGNMKNGADDVKRHRWFRSVDWDAVPQRKLKPP
IVPKVSNDGDTSNFEAYPEDDWNKTPPVPPKDLEIFKNF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccggatgtcattcggctaaagcaagaacagcatgtgcataatgaaaagtca
gttctgaaagaagtcaaccatccatttctcatcagattatattggacctaccatgatgaa
agatttttatatatgttgatggaatatgttcctggaggagaacttttcagctacttgaga
aacatgggacggtttaataacagcacaggactattttactctgcggagattatctgtgca
atagaatatctgcactccaaagaaatagtttacagagatttaaaacctgaaaatatatta
ttagataaagaaggccatatcaagctcactgattttggatttgctaaaaagctagtagac
agaacatggacactctgtgggacaccagaataccttgctccagaagtcatacaaagtaaa
ggtcacggaagagcagtagactggtgggctctggggattctgatatttgagatgctgtct
ggatttcctccattttttgatgacaacccatttggcatctatcaaaaaattcttgcaggc
aaaatagatttccccaggcatttggatctctatgtaaaagaccttattaagaaacttctt
gtggtagataggacaagacgactaggaaacatgaagaatggagcagacgatgtgaaaagg
caccggtggttcaggtctgtggactgggatgcggtaccccagagaaaactgaagcctcct
atagtgccgaaggtttccaatgatggtgatacatctaattttgaagcttatcctgaagat
gactggaataagacaccacctgtgcctcctaaagacttagaaatctttaagaatttctga

DBGET integrated database retrieval system