KEGG   Sarcophilus harrisii (Tasmanian devil): 100928988Help
Entry
100928988         CDS       T02286                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100928988 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100928988 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100928988 (EIF4E2)
   04150 mTOR signaling pathway
    100928988 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100928988 (EIF4E2)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100928988 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 264 aa AA seqDB search
MAPSAEFWAPKVGHWHSAPAMFGCPSLKDDDSGDHDQNEENSTQKDGEKEKSERDKSQSS
SKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHM
VRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFM
VGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSI
KMPGRLGPQRLLFHNLWKTRLNVP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccccctcggctgagttctgggcccccaaagttggacattggcattctgctcctgcc
atgtttgggtgcccaagcttgaaagatgatgacagtggggaccatgaccagaatgaagaa
aacagcacacagaaagacggtgagaaggaaaaaagtgagcgagacaaaagtcagagcagc
agcaagaggaaggctgtggtccctgggcctgcagaacatccgctgcagtacaactacact
ttctggtactcccggaggacgccgggccggccgaccagctcacagagctacgagcagaac
attaagcagatcggcacatttgcctccgtggagcagttctggaggttttatagccacatg
gtacgtcccggggacctgacaggccatagtgacttccatctcttcaaagaggggatcaaa
cccatgtgggaggatgatgcaaataaaaatggcggcaaatggattattcgactccgcaag
ggcttagcatcacggtgctgggagaatcttatacttgccatgttgggagaacagttcatg
gtgggcgaggagatatgtggggcagtcgtctctgtccgtttccaggaggacattatttca
atatggaacaagacagccagtgaccaggcaaccacggcccggatccgggacacgctacgt
cgagtgcttaacctacctcccaacaccatcatggagtacaaaacacacaccgacagcatc
aaaatgccaggcaggctgggcccccaaaggctcctttttcataacctctggaagacgcgg
ttgaatgtgccatga

DBGET integrated database retrieval system