KEGG   Sarcophilus harrisii (Tasmanian devil): 100928988Help
Entry
100928988         CDS       T02286                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:shr03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:shr04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:shr04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:shr04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 264 aa AA seqDB search
MAPSAEFWAPKVGHWHSAPAMFGCPSLKDDDSGDHDQNEENSTQKDGEKEKSERDKSQSS
SKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHM
VRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFM
VGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSI
KMPGRLGPQRLLFHNLWKTRLNVP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggccccctcggctgagttctgggcccccaaagttggacattggcattctgctcctgcc
atgtttgggtgcccaagcttgaaagatgatgacagtggggaccatgaccagaatgaagaa
aacagcacacagaaagacggtgagaaggaaaaaagtgagcgagacaaaagtcagagcagc
agcaagaggaaggctgtggtccctgggcctgcagaacatccgctgcagtacaactacact
ttctggtactcccggaggacgccgggccggccgaccagctcacagagctacgagcagaac
attaagcagatcggcacatttgcctccgtggagcagttctggaggttttatagccacatg
gtacgtcccggggacctgacaggccatagtgacttccatctcttcaaagaggggatcaaa
cccatgtgggaggatgatgcaaataaaaatggcggcaaatggattattcgactccgcaag
ggcttagcatcacggtgctgggagaatcttatacttgccatgttgggagaacagttcatg
gtgggcgaggagatatgtggggcagtcgtctctgtccgtttccaggaggacattatttca
atatggaacaagacagccagtgaccaggcaaccacggcccggatccgggacacgctacgt
cgagtgcttaacctacctcccaacaccatcatggagtacaaaacacacaccgacagcatc
aaaatgccaggcaggctgggcccccaaaggctcctttttcataacctctggaagacgcgg
ttgaatgtgccatga

DBGET integrated database retrieval system