KEGG   Sarcophilus harrisii (Tasmanian devil): 100928988Help
Entry
100928988         CDS       T02286                                 

Gene name
EIF4E2
Definition
(RefSeq) LOW QUALITY PROTEIN: eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr03013  RNA transport
shr04066  HIF-1 signaling pathway
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04211  Longevity regulating pathway
shr04910  Insulin signaling pathway
Module
shr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100928988 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100928988 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100928988 (EIF4E2)
   04150 mTOR signaling pathway
    100928988 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100928988 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    100928988 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100928988 (EIF4E2)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100928988 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100928988 (EIF4E2)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100928988 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100928988
NCBI-ProteinID: XP_023359593
Ensembl: ENSSHAG00000013108
Position
4
AA seq 236 aa AA seqDB search
MMTVGTMTRMKKTAHRKXGEKEKSERDKSQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTP
GRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDAN
KNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASD
QATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFHNLWKTRLNVP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtggggaccatgaccagaatgaagaaaacagcacacagaaagnacggtgag
aaggaaaaaagtgagcgagacaaaagtcagagcagcagcaagaggaaggctgtggtccct
gggcctgcagaacatccgctgcagtacaactacactttctggtactcccggaggacgccg
ggccggccgaccagctcacagagctacgagcagaacattaagcagatcggcacatttgcc
tccgtggagcagttctggaggttttatagccacatggtacgtcccggggacctgacaggc
catagtgacttccatctcttcaaagaggggatcaaacccatgtgggaggatgatgcaaat
aaaaatggcggcaaatggattattcgactccgcaagggcttagcatcacggtgctgggag
aatcttatacttgccatgttgggagaacagttcatggtgggcgaggagatatgtggggca
gtcgtctctgtccgtttccaggaggacattatttcaatatggaacaagacagccagtgac
caggcaaccacggcccggatccgggacacgctacgtcgagtgcttaacctacctcccaac
accatcatggagtacaaaacacacaccgacagcatcaaaatgccaggcaggctgggcccc
caaaggctcctttttcataacctctggaagacgcggttgaatgtgccatga

DBGET integrated database retrieval system