KEGG   Sarcophilus harrisii (Tasmanian devil): 100929055Help
Entry
100929055         CDS       T02286                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A-IV isoform X2
  KO
K08760  
apolipoprotein A-IV
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100929055 (APOA4)
   04979 Cholesterol metabolism
    100929055 (APOA4)
   04977 Vitamin digestion and absorption
    100929055 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
3
AA seq 348 aa AA seqDB search
MQPDQVCKLVWDYFNKLSANAKDAMEQQQKSEFNQQLNTLFQDKCGEASTQTDDLKKKVV
PFAMELPCCLVRDSEKLKEQIRRELEELRQQLQPNQEQVCQKMNENVQTLKQCLGSHANE
LQNSLNENAEHLRQQLCGQLESAMKDNINCVQAALAPFACDFKDKVHQHVDKMKCQLTPY
ADQLQEKINQHIAELQKTLCPFAKGAQEQLNRQLECLAFQMKKNVDQLRNKISDNAEDLK
QKLCPCAEEMRGRQPRNPEEMHQSLTKMNVNVDRQIDEFRRNMKPCGESFNKALVHNLEE
LKQKLGPPRSCGMTDHLSLLEKDLRDKVNNFFNSLKESQEEMICYPKS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgaccaagtatgcaagctggtatgggactacttcaacaagttaagcgccaat
gccaaggatgctatggaacagcaacagaagtcggagttcaaccagcaactcaacacactt
ttccaggataaatgtggggaggctagcacccagactgatgacttaaagaaaaaggtagtt
ccttttgccatggaattgccttgctgtctggtccgggactcagaaaagctcaaggaacag
attcggagggagctggaggagctcagacagcaactccagcccaatcaggaacaggtctgc
cagaagatgaatgaaaatgtgcagaccttgaagcagtgcctggggtcccatgccaatgag
ctccagaacagcctcaatgagaacgcggagcaccttcggcagcagctctgtgggcagttg
gagtcagccatgaaggataacatcaactgtgtacaggcagccctggccccttttgcctgc
gatttcaaggacaaggtccaccaacatgtggacaagatgaagtgccagctcaccccttac
gcagatcagctccaggaaaagatcaaccagcacatcgcggagcttcagaagaccctttgc
ccctttgccaaaggtgcccaagagcagctcaaccgccagctggaatgcctggccttccag
atgaagaagaacgtggatcagctgaggaacaagatctcggacaacgccgaggatctgaag
caaaagctgtgcccctgtgccgaggagatgcgggggaggcagcccagaaaccccgaggag
atgcaccagtccttgaccaagatgaatgtaaatgtagaccggcagattgatgagttccgt
aggaatatgaagccttgtggggagagcttcaacaaggccttggtgcataatctggaagaa
ctcaagcagaaactggggccaccccgctcttgtgggatgacagaccacctcagcttgttg
gagaaggacttgagggacaaagttaacaactttttcaacagtctcaaggagtctcaggaa
gagatgatatgttaccccaagtcttaa

DBGET integrated database retrieval system