KEGG   Sarcophilus harrisii (Tasmanian devil): 100929055Help
Entry
100929055         CDS       T02286                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100929055 (APOA4)
   04977 Vitamin digestion and absorption
    100929055 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 348 aa AA seqDB search
MQPDQVCKLVWDYFNKLSANAKDAMEQQQKSEFNQQLNTLFQDKCGEASTQTDDLKKKVV
PFAMELPCCLVRDSEKLKEQIRRELEELRQQLQPNQEQVCQKMNENVQTLKQCLGSHANE
LQNSLNENAEHLRQQLCGQLESAMKDNINCVQAALAPFACDFKDKVHQHVDKMKCQLTPY
ADQLQEKINQHIAELQKTLCPFAKGAQEQLNRQLECLAFQMKKNVDQLRNKISDNAEDLK
QKLCPCAEEMRGRQPRNPEEMHQSLTKMNVNVDRQIDEFRRNMKPCGESFNKALVHNLEE
LKQKLGPPRSCGMTDHLSLLEKDLRDKVNNFFNSLKESQEEMICYPKS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgaccaagtatgcaagctggtatgggactacttcaacaagttaagcgccaat
gccaaggatgctatggaacagcaacagaagtcggagttcaaccagcaactcaacacactt
ttccaggataaatgtggggaggctagcacccagactgatgacttaaagaaaaaggtagtt
ccttttgccatggaattgccttgctgtctggtccgggactcagaaaagctcaaggaacag
attcggagggagctggaggagctcagacagcaactccagcccaatcaggaacaggtctgc
cagaagatgaatgaaaatgtgcagaccttgaagcagtgcctggggtcccatgccaatgag
ctccagaacagcctcaatgagaacgcggagcaccttcggcagcagctctgtgggcagttg
gagtcagccatgaaggataacatcaactgtgtacaggcagccctggccccttttgcctgc
gatttcaaggacaaggtccaccaacatgtggacaagatgaagtgccagctcaccccttac
gcagatcagctccaggaaaagatcaaccagcacatcgcggagcttcagaagaccctttgc
ccctttgccaaaggtgcccaagagcagctcaaccgccagctggaatgcctggccttccag
atgaagaagaacgtggatcagctgaggaacaagatctcggacaacgccgaggatctgaag
caaaagctgtgcccctgtgccgaggagatgcgggggaggcagcccagaaaccccgaggag
atgcaccagtccttgaccaagatgaatgtaaatgtagaccggcagattgatgagttccgt
aggaatatgaagccttgtggggagagcttcaacaaggccttggtgcataatctggaagaa
ctcaagcagaaactggggccaccccgctcttgtgggatgacagaccacctcagcttgttg
gagaaggacttgagggacaaagttaacaactttttcaacagtctcaaggagtctcaggaa
gagatgatatgttaccccaagtcttaa

DBGET integrated database retrieval system