KEGG   Sarcophilus harrisii (Tasmanian devil): 100929056Help
Entry
100929056         CDS       T02286                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100929056 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100929056 (GRIA4)
   04728 Dopaminergic synapse
    100929056 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100929056 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100929056 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100929056 (GRIA4)
   05033 Nicotine addiction
    100929056 (GRIA4)
Ion channels [BR:shr04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100929056 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 433 aa AA seqDB search
MRIICRQLVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDASYRRLLEDLDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFMHGGANVTGFQLVDFNTPMVTKLMQRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMPLMKNPILRN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagcttgtcttgttattttctggattttggggactagcgatg
ggagcttttccaagcagcgttcaaataggtggtctattcatcagaaacacagatcaggaa
tatactgctttccgattagcaatctttcttcataacaccagccccaatgcatcggaggca
ccttttaatttggttcctcatgtggacaacattgaaacagccaacagctttgctgtaaca
aatgccttttgttcccagtattctcgaggagtttttgccatttttggactctatgataag
agatcagtacatactttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctaccgagggggagagtcagtttgtgctgcaactgagaccttctctccgagga
gcactcttgagtttgttggatcactatgaatggaactgttttgttttcctgtatgacaca
gataggggatactctatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagtgccatatgtgtggaaaactttaatgatgccagctacagaagacttctagaagat
ctggatagaagacaagaaaagaaatttgtaatagactgtgaaatagagagacttcaaaac
atattagaacagattgtcagtgttggaaaacatgttaaaggataccattatatcattgca
aatctgggattcaaggatatttctctggagaggttcatgcatggaggagccaatgtgaca
ggattccagttagtagattttaatacacctatggtgactaaactcatgcagcgctggaaa
aaactagatcaaagagagtacccaggatcagagacacctcctaagtatacatctgccttg
acatatgatggggtgcttgtgatggcagaaacttttcgcaatcttagacgacagaaaatt
gatatttcaaggagggggaatgctggagattgtctggccaatcctgctgcaccatggggc
cagggaattgatatggagaggacactcaaacaggttcgaattcaagggttgactggaaat
gttcaatttgaccactatggacgaagagtcaactacacaatggacgtatttgagctgaag
agtacaggacccagaaaggtgggttattggaatgatatggataaattagttctaattcaa
gatgtacccacacttggcaatgacactgcagctattgaaaatagaacagttgttgtaacc
acaatcatgcctctgatgaagaatcctattttaagaaattga

DBGET integrated database retrieval system