KEGG   Sarcophilus harrisii (Tasmanian devil): 100929063Help
Entry
100929063         CDS       T02286                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100929063
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100929063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 269 aa AA seqDB search
MCKYEEQRPRFAFGIGGRKFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPIT
EKYEVFRIEEEEKIKSEGQDVTESVYFMKQTISNACGTIGLIHAIANNKDKMNFESGSTL
KKFLEESLSMSPEERARYLEKYEAIRVTHESSAHEGQTEGAELGPKSGSYWEANFSSLEN
VLQQLKPPESHMDCHVEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDDTL
LEDAIEVCKKFMERDPEELRFNAIALSAA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaagtatgaggagcaaaggcctcgttttgcttttggaataggtggtcgaaaattt
cttaaacaattaggtctacatcccaactggcaatttgttgatgtgtatggtatggaacct
gaactccttagcatggtgccacgaccagtttgtgcagtattacttctctttccaattaca
gaaaagtatgaagtattcagaatagaagaggaagaaaaaataaaatcagaaggacaagac
gtcacagaatcagtatatttcatgaagcaaaccatcagtaatgcctgtggaacaattgga
ctgatccatgctattgctaacaacaaagacaaaatgaattttgaatctggatcaacattg
aagaaattcttggaagaatctctaagtatgagtcctgaagaaagagccagatacctagaa
aaatatgaagcaattcgagttactcatgaatcgagtgcccatgaaggtcagacagagggg
gcagaactgggaccgaagagtggaagttactgggaggcaaatttcagctcattagaaaac
gttcttcaacaattaaagccacctgaaagtcatatggactgccatgttgaggcaccaagt
atagatgaaaaagtagatctgcattttattgcattagttcatgtagatgggcatctctat
gaattagatggacgcaagccatttccaattaaccatgggaaaactagtgatgatacttta
ttagaggatgccatagaagtttgcaagaagttcatggaacgtgacccagaagaattaaga
tttaatgcaattgctctttctgcagcatag

DBGET integrated database retrieval system