KEGG   Sarcophilus harrisii (Tasmanian devil): 100929066Help
Entry
100929066         CDS       T02286                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100929066 (KMT5C)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100929066 (KMT5C)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100929066 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100929066
NCBI-ProteinID: XP_023356720
Ensembl: ENSSHAG00000005963
Position
3
AA seq 329 aa AA seqDB search
MTAAHRHHGDSGLTVTRTNGAGEQHGPGCTMGPEKVTARELCENDDLATSLVLDPYLGFR
THKMNVSPVPPLRRQPHLRSALEAFRKQRDLEAAYRALTLGGWMAHYFQSRGPQQEAALK
THIYRYLRAFLPESGFAILPCTRYSLETNGAKVVSTRSWKKNEKLELLVGCIAELREADE
GLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCRPNCKFVPADGNAACVKVLRDIEPG
DEVTCFYGDGFFGERNELCECCTCERKGEGAFRLRPRDTALATPRTCEKYDLRETEHRLQ
RYWESRGVRQGLGPLGAQRCSHLHTLGTP
NT seq 989 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcgcacaggcaccatggcgacagtggactgacagtgacaaggaccaatggg
gctggtgagcagcatggtccaggctgcaccatgggaccagagaaggtgacagccagggag
ctgtgtgagaacgatgacctcgccaccagcttggtcctggatccctacctgggcttccgc
acacacaagatgaacgtcagcccagtgccccctctgcggcgtcagccccacctgcgttcg
gcactcgaggccttccggaaacagcgggacttggaggccgcctaccgggccttgacgctg
ggcggctggatggcccactacttccagagccgtggcccgcagcaggaagctgccctcaag
acccatatctatcggtaccttcgagccttcctgcctgaaagtggctttgccatccttccc
tgcacccgatactccctagaaaccaatggggccaaggtcgtgtctacccgctcctggaag
aagaacgagaagctggagctgctcgtgggctgcatcgccgagctgcgggaggccgacgag
ggcttgctgcgggccggggagaacgacttcagcatcatgtactccacccgcaaacgcagc
gcccagctatggctggggcctgcggccttcatcaaccatgactgcagacccaattgtaag
tttgtgcccgcagacgggaacgcggcctgcgtgaaggtgctccgagacatcgagcccggg
gacgaggtgacctgcttctacggggacggcttcttcggggagcgcaatgagctgtgcgaa
tgctgcacctgtgagaggaagggggaaggcgcctttcgattgcggccccgggacacggcc
ttggccactcccaggacctgtgaaaagtacgacctccgggagaccgagcaccggctgcag
cgctactgggagtcccgaggggtgcggcagggcctcgggcccctgggggcccagcgctgc
tctcacctgcacaccctcgggactcccag

DBGET integrated database retrieval system