KEGG   Sarcophilus harrisii (Tasmanian devil): 100929066Help
Entry
100929066         CDS       T02286                                 

Gene name
SUV420H2
Definition
suppressor of variegation 4-20 homolog 2 (Drosophila)
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100929066 (SUV420H2)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100929066 (SUV420H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 350 aa AA seqDB search
MGPEKVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQPHLRSALEAFRKQRD
LEAAYRALTLGGWMAHYFQSRGPQQEAALKTHIYRYLRAFLPESGFAILPCTRYSLETNG
AKVVSTRSWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHGEGGGGERAGERTLIGSAGGSPANGVPARAEGSLPECLFSNSCIDPISLARRLRQLE
KGRGLLPQPEQPIWGGNSPKSAFIQPPPTHRLSVLPPGRKQHKVDPSSSCWGVQGALGKA
PRGQPSLPPAQLTRFLPSSSAHDPFYHAHSLIFRPPKEPLTAPGVGPGAS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggaccagagaaggtgacagccagggagctgtgtgagaacgatgacctcgccaccagc
ttggtcctggatccctacctgggcttccgcacacacaagatgaacgtcagcccagtgccc
cctctgcggcgtcagccccacctgcgttcggcactcgaggccttccggaaacagcgggac
ttggaggccgcctaccgggccttgacgctgggcggctggatggcccactacttccagagc
cgtggcccgcagcaggaagctgccctcaagacccatatctatcggtaccttcgagccttc
ctgcctgaaagtggctttgccatccttccctgcacccgatactccctagaaaccaatggg
gccaaggtcgtgtctacccgctcctggaagaagaacgagaagctggagctgctcgtgggc
tgcatcgccgagctgcgggaggccgacgagggcttgctgcgggccggggagaacgacttc
agcatcatgtactccacccgcaaacgcagcgcccagctatggctggggcctgcggccttc
atcaaccatggtgagggcggtggcggggagagggccggggagcgaaccctgattggctcc
gcgggcggcagcccggccaatggggtcccagcacgcgcggaaggttcgcttcccgagtgc
ctcttctccaactcttgtattgatcccatttccctggctcggagattgaggcagctggaa
aaagggaggggcctcctccctcagcccgagcagcccatttgggggggcaactccccgaaa
tcagcttttatccaacccccacccacccatcgactttcggtccttccgcctggaaggaag
caacacaaggtggatccctcctcctcctgctggggtgtccagggagccctcggaaaagca
cccaggggccagccctctctcccgccagcacaattgacccgcttcctccccagctcctca
gcacatgaccccttctatcatgctcactctctcatcttcagacctcctaaagaacccctc
actgctccaggggtcgggccgggggcctcatga

DBGET integrated database retrieval system