KEGG   Sarcophilus harrisii (Tasmanian devil): 100929215Help
Entry
100929215         CDS       T02286                                 

Gene name
GSTT2B
Definition
(RefSeq) glutathione S-transferase theta 2B
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100929215 (GSTT2B)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100929215 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    100929215 (GSTT2B)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100929215 (GSTT2B)
   05225 Hepatocellular carcinoma
    100929215 (GSTT2B)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100929215 (GSTT2B)
  Drug resistance
   01524 Platinum drug resistance
    100929215 (GSTT2B)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100929215 (GSTT2B)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100929215 (GSTT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 231 aa AA seqDB search
MSRPIASLVGRGEGLFASLDTSALLLGQQMTDDFAKVNSLKRVPALKDGDFTLAECSAIL
HYLSQKYNTPGHWYPSDLQSRARVEEYLSWHADSIRGTFGTMLWIQMLGPLVDVHVPQEK
VDRNIALMTQLLQQLEEKFLQDKPFLTGDHISFADLMSLEELIQTVYAGYDVFKDRPKLA
AWRGRVEATLGEKLYQETREAIHKLCTDPSAFKDIPSAMQERMKLRLMKIP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcccatcgcgagcttagtgggaaggggagaaggcctatttgcctcattggac
acatctgctctccttttagggcaacaaatgactgatgattttgccaaagtgaacagcctg
aagagagtgcctgccctgaaggatggagatttcaccttggctgaatgttcggccatcctg
cactacctgagtcagaaatacaatactccaggtcactggtatccttcagatctgcagtcc
cgggcacgggtggaggaatatctgtcctggcatgccgactctattcgaggaacttttggt
acaatgctatggattcagatgcttggccctctcgttgacgtccacgtcccgcaggagaaa
gtggacaggaacatagccttgatgacccagctcctgcagcagctggaggagaagttcctg
caggacaagcccttcctcactggtgaccacatttccttcgcggatctgatgtcgctagag
gagctgatacagaccgtctatgctggttatgatgtcttcaaagatcggcccaagctggca
gcttggcgtgggcgggtggaggccaccttgggggaaaagctgtaccaagagacccgggaa
gccatccataaactctgtacagatcctagtgccttcaaggacatcccttcagccatgcag
gagaggatgaaattacgtctcatgaagatcccctaa

DBGET integrated database retrieval system