KEGG   Sarcophilus harrisii (Tasmanian devil): 100929261Help
Entry
100929261         CDS       T02286                                 

Gene name
SETD7
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:shr00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:shr04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 308 aa AA seqDB search
TLEGYYVDDALQGQGVYTYEDGGVLKGTYADGELNGPAQEYDSDGRLIFKGQYKDNIRHG
ICWIYYPDGGTLVGEVNEEGEMTGDKIAYVYPDERTTIYGKFIDGELIEGKLANMSIEEG
KPYFELVPGSSVYHFDKSTPSCISTNPLLPDPYESERVYVAESHIPNAGEGLFSKVAVGP
NTVISFYNGIRITHQEVDDRDWDLNGNTLSLDDETVIDVPEPYNHTSKYCASLGHKANHS
FTPNCIYDMFAHPRFGPIKCIRTKQAVERDEELTVAYGYDHNPPGKSMPEAPEWYQMELK
VFQAAQEK
NT seq 928 nt NT seq  +upstreamnt  +downstreamnt
cacactggaaggatattatgtggatgacgctttgcaggggcagggagtatacacctatga
ggatggtggagtgctcaaaggcacctatgcagatggagagctgaacggaccggcccaaga
gtatgactcagatgggagactgatcttcaagggacaatacaaagataacattcggcatgg
aatttgctggatatattacccagatggaggtactctggtgggtgaagttaatgaagaagg
ggagatgactggagacaaaatagcctatgtgtaccctgatgaaaggaccacaatttatgg
gaaattcatagatggagagttaatagaaggaaaattggctaacatgtcaattgaggaagg
aaagccctactttgaactggtgccgggaagttctgtctatcattttgataagtcaactcc
atcctgcatttctacaaatccccttcttcctgatccttatgagtcagaaagggtttatgt
tgctgaatcacacattcccaatgctggagaaggactgttttctaaagtagcagtgggacc
caacacagttatatcattttataatggaatccgaattacacaccaagaagtggatgacag
agactgggaccttaatggaaacacactctctcttgatgatgaaacggtcatcgatgtgcc
tgaaccctacaaccacacatccaagtactgtgcctctctgggacacaaggctaatcactc
ctttactcctaactgcatctatgacatgtttgcacatccacgttttgggcccatcaaatg
catccgcaccaaacaagcagtggagagagatgaggagctcactgtcgcctacggttatga
tcacaatcctcctggaaagagcatgcccgaagccccagagtggtaccagatggaactgaa
ggtcttccaggctgcccaggagaagtga

DBGET integrated database retrieval system