KEGG   Sarcophilus harrisii (Tasmanian devil): 100929283Help
Entry
100929283         CDS       T02286                                 

Definition
(RefSeq) carboxylesterase 3
  KO
K15743  carboxylesterase 3/5 [EC:3.1.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100929283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Esterase
Motif
Other DBs
NCBI-GeneID: 100929283
NCBI-ProteinID: XP_023350803
Position
1
AA seq 565 aa AA seqDB search
MPGGQKSLLWFLTCITWLLILPAEGQEAPGPEVMTQFGRVRGKQVTVKGTEHRVDVFLGI
PFANPPVGAGRFSPPQPAEPWEGIRDATTFPPMCLQEVERTELMKNTLDGKQQLFPISED
CLYLNIYTPASRHKKAKLPVMVWFHGGSFVIGTASSYDGSPLSAYEDIVVVTVQYRLGFQ
GFLSTGDKFAPGNWGFLDLVAALQWVQSNIVHFGGDPNCVTISGQSAGGMCVSALVLSPM
TKGLFHKAIAQSGVLTMSGIVTDHPQHTFQEIVCLFGCEGSNSAALFQCLQNKENMIFNR
KFSTLPFVPATVDGVFLPKFPEELLLEKKFPRIPYLLGVNNHEFGHMIPSAWTFLNMKTG
MKKESVFPFLKKVATNVLDIPPELIHLVIEEYIGNHTDPLAIQEAVMDIFGDVIIIIQVL
KVSKNHRDSGAPVYLYEFQHRPSTFDKIKPTYVKADHSAELTFVFGGPFMADEHSMLAFP
DSTEEEKQLSRTMMRYWANFIRTGDPNEEGLPTWPLYDQSESYLELSLTPKVGRKLKEDK
VEFWEKIADEKVKLYHKGKKGHTEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaggacagaagtctctgctttggtttttaacctgcattacctggctcctgatt
cttccagctgagggacaagaggctcctgggcctgaagtgatgactcagtttggtcgagtc
cgggggaaacaggtcactgtcaagggaactgagcatcgtgtggatgttttcctgggaatc
ccatttgccaatcccccagtgggagctgggagattctctcccccacagcctgctgagcct
tgggagggcataagagatgccactacattccctccaatgtgtttgcaggaggtagaaagg
acagaacttatgaaaaacactttagatgggaagcagcaactcttcccaatatctgaagac
tgtctctatcttaacatctacaccccagcctccagacacaagaaggctaagttacctgtg
atggtttggttccatgggggatcatttgtaattggaacagcttcctcatatgatgggtca
cctttatcagcctatgaagatattgtggtggtaacagtacaatacagactgggattccag
ggatttttgagcactggggataagtttgcacctggtaactggggattcttggatctggtg
gctgctttacaatgggtccagagcaacattgttcactttggaggagaccccaactgtgtg
accatctctggacaatctgcaggaggaatgtgtgtctctgcacttgtgctgtctcctatg
accaaaggtctattccataaagccattgcacagagtggggttctcaccatgtcaggtata
gtcacagaccaccctcagcacacttttcaggagattgtttgcctttttggctgtgaaggt
tccaactcagctgctttgttccagtgcttacagaataaagaaaacatgatattcaacagg
aaattctcaaccctaccttttgtcccagccactgtggatggtgttttcttaccaaagttc
ccagaagagctcctcttagagaaaaaatttccgagaattccctatttgcttggagtcaac
aatcatgagtttggtcacatgataccttcggcatggacgttcctaaacatgaaaactgga
atgaaaaaagaatcagtattcccctttttgaagaaagtagccactaatgtcctggacatc
ccccctgagttgatccatttagttatagaagagtacattggtaaccacacagacccacta
gccattcaggaagcagttatggatatatttggagatgtaattataattattcaagttctg
aaggtatcaaagaatcacagagattctggagctccagtctatttatatgaattccagcat
cggccaagtactttcgataaaatcaaacctacttatgtaaaagctgaccattccgctgag
ctcacattcgtttttggaggccctttcatggcagatgagcactccatgttggcttttcca
gactccactgaagaagagaaacagctaagcagaacaatgatgaggtactgggccaatttc
attcggacaggggatcccaatgaagaagggctgccgacttggcctctctatgaccaatca
gagtcatacctagagctcagcttgactccaaaggtgggaagaaaactcaaagaggacaaa
gtggagttttgggaaaaaatcgctgatgaaaaagttaagctatatcataaaggaaagaag
gggcatactgaattgtga

DBGET integrated database retrieval system