KEGG   Sarcophilus harrisii (Tasmanian devil): 100929283Help
Entry
100929283         CDS       T02286                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100929283 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 566 aa AA seqDB search
MPGGQKSLLWFLTCITWLLILPAEGQEAPGPEVMTQFGRVRGKQVTVKGTEHRVDVFLGI
PFANPPVGAGRFSPPQPAEPWEGIRDATTFPPMCLQEVERTELMKNTLDGKQQLFPISED
CLYLNIYTPASRHKKAKLPVMVWFHGGSFVIGTASSYDGSPLSAYEDIVVVTVQYRLGFQ
GFLSTGDKFAPGNWGFLDLVAALQWVQSNIVHFGGDPNCVTISGQSAGGMCVSALVLSPM
TKGLFHKAIAQSGVLTMSGIVTDHPQHTFQEIVCLFGCEGSNSAALFQCLQNKENMIFNR
KFSTLPFVPATVDGVFLPKFPEELLLEKKFPRIPYLLGVNNHEFGHMIPSGGIKEEPDEM
HLADQVPDLSKNMLINISKDIPPELIHLVIEEYIGNHTDPLAIQEAVMDIFGDVIIIIQV
LKVSKNHRDSGAPVYLYEFQHRPSTFDKIKPTYVKADHSAELTFVFGGPFMADEHSMLAF
PDSTEEEKQLSRTMMRYWANFIRTGDPNEEGLPTWPLYDQSESYLELSLTPKVGRKLKED
KVEFWEKIADEKVKLYHKGKKGHTEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaggacagaagtctctgctttggtttttaacctgcattacctggctcctgatt
cttccagctgagggacaagaggctcctgggcctgaagtgatgactcagtttggtcgagtc
cgggggaaacaggtcactgtcaagggaactgagcatcgtgtggatgttttcctgggaatc
ccatttgccaatcccccagtgggagctgggagattctctcccccacagcctgctgagcct
tgggagggcataagagatgccactacattccctccaatgtgtttgcaggaggtagaaagg
acagaacttatgaaaaacactttagatgggaagcagcaactcttcccaatatctgaagac
tgtctctatcttaacatctacaccccagcctccagacacaagaaggctaagttacctgtg
atggtttggttccatgggggatcatttgtaattggaacagcttcctcatatgatgggtca
cctttatcagcctatgaagatattgtggtggtaacagtacaatacagactgggattccag
ggatttttgagcactggggataagtttgcacctggtaactggggattcttggatctggtg
gctgctttacaatgggtccagagcaacattgttcactttggaggagaccccaactgtgtg
accatctctggacaatctgcaggaggaatgtgtgtctctgcacttgtgctgtctcctatg
accaaaggtctattccataaagccattgcacagagtggggttctcaccatgtcaggtata
gtcacagaccaccctcagcacacttttcaggagattgtttgcctttttggctgtgaaggt
tccaactcagctgctttgttccagtgcttacagaataaagaaaacatgatattcaacagg
aaattctcaaccctaccttttgtcccagccactgtggatggtgttttcttaccaaagttc
ccagaagagctcctcttagagaaaaaatttccgagaattccctatttgcttggagtcaac
aatcatgagtttggtcacatgataccttcgggagggatcaaggaggagccagatgaaatg
cacctggcagaccaagtcccagatctgtctaaaaatatgctaatcaatatctcaaaggac
atcccccctgagttgatccatttagttatagaagagtacattggtaaccacacagaccca
ctagccattcaggaagcagttatggatatatttggagatgtaattataattattcaagtt
ctgaaggtatcaaagaatcacagagattctggagctccagtctatttatatgaattccag
catcggccaagtactttcgataaaatcaaacctacttatgtaaaagctgaccattccgct
gagctcacattcgtttttggaggccctttcatggcagatgagcactccatgttggctttt
ccagactccactgaagaagagaaacagctaagcagaacaatgatgaggtactgggccaat
ttcattcggacaggggatcccaatgaagaagggctgccgacttggcctctctatgaccaa
tcagagtcatacctagagctcagcttgactccaaaggtgggaagaaaactcaaagaggac
aaagtggagttttgggaaaaaatcgctgatgaaaaagttaagctatatcataaaggaaag
aaggggcatactgaattgtga

DBGET integrated database retrieval system