KEGG   Sarcophilus harrisii (Tasmanian devil): 100929303Help
Entry
100929303         CDS       T02286                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100929303 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 592 aa AA seqDB search
MPLYTELPLVEKKIRSVHKSVVMYLILGSFPGLCNFQTTNNLCRVYKIAHDAWALYLRLG
APVAARSPCPQARTRAPRPFLEVTAYGGKGRPAPVPIRSSGEICRDTSEVQGDAECGMDW
GRGVVLPVCLSSTQISPLIKKISEHKDFKKLLRTRNNVLVLYSKSAAAAENHLRLLSNVA
KAVKGQGTISWVDCGYVLGIRSIVAFLKDPEGAPLWEEDPEAKDVVHIDSEKEFRRIVKK
DDKPLLMMFYAPWCAMCKRMMPSFQQAATELKGTHVLAGMNVYSSEFEHIKEEYDVRGYP
TICYFEKGKFLFQYENYRSTAKDIVEWMKNPQAPQPQVPEAAWADEGSVVYHLTDEDFDK
FVKEHSSVLIMFHAPWCGHCKKMKPEFESAAETLHGAADSPGVLAAIDATVNKATAERYQ
ISGFPTLKYFKDGEEKYTLPQLRTKKKIIEWMQNPEAPPPPEPAWEEKQTSVLHLTGVDF
REALKKKKHALVMFYAPWCPHCKNTIPNFTATAELFKDDRKIACAAVDCAKDKNRDLCKQ
EGVDGYPTFNYYNYGKMIEKYNGDRTESGFVSFVRTLRERDHERLGKKKDEL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctacactgaactccctcttgttgagaagaaaatcagatctgtacataaatct
gtggtcatgtatcttatccttggctcctttccaggactttgtaactttcaaaccactaat
aatctttgtcgggtatacaagatcgcacacgatgcttgggctctgtacctgagacttggt
gctccggtggcggcgcggtccccttgcccccaggcccggacccgcgccccgcgccccttc
ctggaggtcactgcctacggcggcaaagggcgtcctgctcccgtgcccattcgctcttcc
ggagagatctgccgagacacctcggaggtccagggagatgcggagtgtgggatggattgg
ggacgaggagtagtccttccagtgtgtctatcctccactcagatctccccactcatcaag
aaaatctctgaacataaagatttcaagaaacttctcaggactcggaataatgtattggtg
ctttactccaaatctgctgctgcagccgaaaaccacctcagattactgtctaacgtggcc
aaagcagtgaaaggacaaggcaccatctcctgggtggactgtgggtatgtattggggatt
aggtccatagtggcttttctgaaggatccagaaggggcccctctttgggaagaagatcct
gaagctaaagatgttgtccacattgacagtgaaaaggaattcagacggattgtgaagaag
gatgacaaacctcttctgatgatgttctatgccccttggtgtgccatgtgtaagcggatg
atgccatctttccaacaggcagccacagaactaaaaggcacccatgtgctggctgggatg
aatgtctactcctctgaatttgaacacatcaaggaagagtatgatgtccgtggctacccc
accatctgctattttgagaaagggaagtttctgttccagtatgaaaactataggtccaca
gccaaggacattgtggaatggatgaagaatccacaagcgccacagccccaggtccccgag
gctgcctgggcagacgagggaagcgtcgtttatcatctgaccgatgaagactttgacaag
tttgtgaaggagcactcctctgtcctcatcatgtttcatgccccatggtgtggacattgt
aagaagatgaagcccgagtttgagagtgcagccgagaccctccatggagcagcagatagt
ccaggtgtccttgcagccattgatgccactgtcaataaagccactgcagaacgatatcag
atctcaggcttccctacactaaaatattttaaggatggagaagaaaagtataccttgcca
cagcttagaacaaagaagaagattatcgagtggatgcagaatcctgaggcacccccaccc
ccagagcctgcatgggaagaaaagcaaaccagtgtactgcacctgacgggagtggacttt
cgggaagccctgaagaaaaagaaacatgctcttgtcatgttctacgcaccctggtgtcca
cattgtaaaaatacaatcccgaacttcactgccactgctgaacttttcaaagacgaccgg
aagattgcctgtgctgcagttgactgtgccaaagataagaaccgggatctatgtaagcag
gaaggggttgatggctaccccaccttcaactactacaactatgggaagatgatcgaaaaa
tataatggagatcggacggagtcagggtttgtctcttttgttcgaactctccgagagcga
gaccatgagcgacttggaaaaaagaaagatgaattgtga

DBGET integrated database retrieval system