KEGG   Sarcophilus harrisii (Tasmanian devil): 100929505Help
Entry
100929505         CDS       T02286                                 

Gene name
PFKL
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:shr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:shr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:shr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:shr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 788 aa AA seqDB search
MASPAIAALGGLDQLRICGAGAGRALGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIY
EGYEGLVEGGNNIRQATWLSVSNIIQMGGTIIGSARCKAFTTREGRLAAAHNLVQHGIAN
LCVIGGDGSLTGANIFRMEWGSLLQQLVKEGKITEDVAQKYSHLNIVGLVGSIDNDFCGT
DMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPE
SPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPITSSYVKELVVKRLGFDTR
VTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATPDTPGCVVTLSGNQSVRLPLMECV
QVTKEVQKAMNEQRFEEAIQLRGRSFENNWNIYKLLAHQKLSQEKSNFSVAILNVGAPAA
GMNAAVRSAVRIGISQGHKVYVIHDGFEGLAKGQVREVGWHDVAGWLGRGGSMLGTKRTL
PKTCLEKIVENVRKYNIQALLVIGGFEAYEGVLQLVEARGRYEELCFVMCVIPATISNNV
PGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAA
YIFEDPFNIHDLKANVEHLTDKMKTDIQRGLVLRNEKSHEHYTTDFLYNLYSSEGKGVFD
CRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSDKLRESYRKGRVFANSADTACVIGL
RKKAVAFSPVTELKKVTDFEHRMPRDQWWLDLRLMLKMLANYQISLTEYVSGKMEHVTLR
TLSIEKGF
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccggcgatagcagcgctgggggggctggaccagctgcggatatgcggggcc
ggggccggccgagccctgggcgtgctcacgagtggcggggacgcccaaggcatgaacgcg
gccgtccgggctgtgacccgaatgggcatctatgtgggggccaaagtcttcctcatctat
gagggctacgagggcctggtggaagggggcaacaacatccggcaagccacatggctgagt
gtctccaacatcatccagatgggaggcaccatcattggcagtgcccgctgcaaggcattc
accaccagggagggccgcctggctgctgcccacaacctggtccagcacggcatcgccaac
ctgtgcgtcatcggtggggacggcagcctgacgggggccaacatattccggatggagtgg
gggagcctcctgcagcagctggtgaaggaagggaagatcactgaagatgtggcccagaag
tactcgcacctcaacatcgtggggctggtgggctccattgacaatgacttctgcgggaca
gacatgaccattggcaccgattcagcccttcatcggatcatggaagtgatcgatgccatc
accaccacagcccagagccaccagagaacttttgtgctggaggtgatgggccggcactgc
gggtacttggccttggtgtcggccttggcatcgggtgccgactggctctttatccccgaa
tccccccccgaggatggctgggagaacttcatgtgtgagagacttggggagactcggagc
agaggatccaggctgaacattatcatcatcgcagaaggagccattgaccgtcacgggaag
cccataacctccagttatgtgaaggaactggtggttaagcgcctgggatttgacactcga
gtgactgttctgggtcacgtgcagcggggagggaccccttctgcatttgaccgtgtcttg
agcagcaagatgggcatggaggctgtaatggccttgctggaggccacaccggatactccc
ggctgcgtggtgaccctctctgggaaccaatctgtccggctgccactgatggagtgtgtc
caggtgacaaaggaagtacagaaggccatgaatgagcagaggtttgaggaggctatccag
ctacgtggcaggagttttgaaaataactggaacatctataagctgctggcccatcagaaa
ctctcccaggagaagagtaacttctccgtcgccattctgaacgtgggggcgccagcggcc
ggcatgaacgccgccgtgaggtctgcggtacggatcggcatatctcaggggcacaaggtc
tacgtcatccacgatggcttcgaaggcttggccaagggacaggtgcgggaggtgggctgg
catgatgtcgctggctggttggggcgcggaggatccatgctcgggactaaaagaactctg
cccaaaacctgcctggagaaaattgtggagaacgtgcggaagtacaacatccaagccctg
ctggtcattgggggctttgaggcctatgagggcgtgctgcagctggtggaggcccgtggt
cggtacgaggagctctgcttcgtcatgtgcgtcatacccgccaccatcagcaacaacgtt
cctggcaccgacttcagcctgggctccgacacggccgtcaatgccgccatggagagctgt
gaccgcatcaaacagtcagcttctggcaccaagcggcgggtgttcattgtggagacgatg
ggaggctactgtgggtacctggccacggtgacaggcatcgcggtgggggctgatgccgcc
tacatcttcgaggaccccttcaacatccatgacctgaaggccaacgttgaacatctgacg
gacaagatgaagacggacatccagcgggggctggtgctccggaacgagaagtcccatgaa
cattacactacggatttcctgtataacctgtactcctcggaggggaagggcgtctttgac
tgcaggaccaacgtcctggggcacctgcagcagggaggagcccccaccccctttgaccga
aactatggcaccaaactcggggtaaaggccatgctctggatgtcggacaagttgcgagag
tcctaccggaaggggcgggtttttgccaactcggcggacacggcctgtgtgattggcctg
aggaagaaggccgtggctttcagcccagtcaccgaactcaagaaggtcacggattttgag
caccgcatgccccgggaccagtggtggttagacctcaggctgatgctcaagatgctggcc
aattaccagatcagcctgacagagtacgtctctgggaagatggagcacgtcaccctgcgc
accctgagcatcgagaagggcttctga

DBGET integrated database retrieval system