KEGG   Sarcophilus harrisii (Tasmanian devil): 100929508Help
Entry
100929508         CDS       T02286                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100929508 (USP44)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100929508 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 717 aa AA seqDB search
MDKCKHVGRLRLAQDHSILNPQKWHCVDCNTTDSVWACLSCSHVACGRYIEEHALKHFQD
SNHPVALEVNELYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYNCTTRSGRILRSM
GTSDDSYPSHGGAQALLRNEDQMFTALWHRRRMLMGKVFRSWYEQTPIGKRQLEEEKLQE
EAEAKREEARRRRQELKRQFKAEMERMPPRKSSRLQGLAKSGVTEMLPIKKLVRSPASPV
IGKKVSTSHEIRLKKVSDSPIKRRPTVTPGVTGLRNLGNTCYMNSILQVLSHLLIFRQCF
LKLDLNQTQELLATAASGKTRSSCKHPPVTDSMFHIKENQEKYKGSPGLRRSSLSSGLSG
GASKSRSMELIQPREPSSKYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRG
YAQQDAQEFLCELLDKVQHELETTGTRYPALIPSSQKKLIKQVLNVVNTIFHGQLLSQVT
CLACDNKSNTVEPFWDLSLEFPERYHCNGKEMAAQYPCLVTEMLAKFTETEALEGKIYVC
DQCNTKRRKFSSKPVILTEAQKQLMVCRLPQVLRLHLKRFRWSGRNHREKIGVHVGFDEI
LNMEPYCYRESLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKL
NMCTLEEVCKAQAYILFYTQRAPQEGEYSRLSAPELLSPRPQPAREEANPPLSARRS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggataaatgcaagcatgttgggcggcttcggcttgctcaagatcattccatcctcaat
cctcaaaaatggcattgtgtggattgtaatacgacagattcagtgtgggcttgccttagc
tgttcacacgtggcatgtggaagatatattgaagaacatgcactcaagcactttcaggac
agtaaccacccagtagcattggaggtgaatgagttgtatgttttctgttatctttgtgat
gactatgttcttaatgataatgcaaccggtgacttgaaattattacggagtaccttgagt
gcaatcaaaagtcagaattataactgtactactcggagtggaaggattttacgctctatg
ggtaccagtgatgactcttacccttcacatggtggtgcccaagctctccttcgaaatgaa
gatcaaatgttcactgctctttggcataggagacggatgttaatgggcaaagtatttaga
tcttggtatgaacaaactcccattggaaaaaggcaattagaagaagaaaaacttcaggaa
gaagcagaagccaagagagaagaagcaagaagacgacgacaggaactgaagcgtcagttt
aaggcagaaatggagcgaatgcctccaagaaaaagttcacgtttgcaaggccttgccaaa
tctggtgttacggaaatgctccctataaagaaacttgttcggagcccagcatcaccagtg
attggtaaaaaagtgtctacctcacatgaaataagattaaaaaaagtgagtgattctccc
atcaaacgaagaccaacagtgactcctggggtaacaggattgaggaatttgggtaatacc
tgctatatgaattctatcttgcaggtattaagtcatttacttatttttcgacagtgtttt
ttaaaattggatctgaaccaaactcaagaattgctggctacagctgctagtgggaagact
agatcttcttgtaaacatccaccagtcacagattctatgtttcacataaaagaaaatcaa
gaaaaatacaaaggctctcctgggttaagacgctcaagtctgtcttcaggtttaagtggt
ggtgcatctaaaagcaggagcatggaacttattcagcccagggagccaagttccaaatac
atttctctttgtcatgaactgcatactcttttccaagttatgtggtctggaaaatgggca
ttggtgtcaccttttgccatgctacattcagtatggaggctaataccagcattccgtggt
tatgcccagcaagatgctcaggaattcctctgtgaacttttggataaagtacagcatgaa
ctagagacgacaggtaccaggtatccagctctcatccccagttctcaaaagaaacttatc
aaacaggttttgaatgtggtgaataccatctttcatggacagcttcttagtcaggttaca
tgtcttgcatgtgataataagtcaaatacagtcgaacctttctgggacctgtcactggaa
tttcccgaaagataccactgtaatggaaaagaaatggctgcccagtatccatgcttggtt
acagaaatgttggccaagttcacagaaactgaagctttagaaggaaaaatatatgtgtgt
gaccagtgtaacacaaagcgcaggaaattttcttcaaaaccagttatactcacagaggcc
cagaaacagcttatggtgtgtcggctgcctcaagttctgagactacaccttaaacgattc
aggtggtcagggcgtaatcatcgagagaaaataggagtacacgttggttttgatgaaatt
ctaaacatggagccatattgctacagagagtctttaaagtccctcagaccagaatgtttc
atctatgacttgtctgctgtcgtcatgcatcatgggaaagggtttggctcaggacactat
actgcatactgctacaactctgaaggaggattctgggtacactgcaatgattccaagctt
aacatgtgcactctggaagaagtgtgtaaggcccaagcttacatcttattttatacccag
cgagctcctcaggagggcgaatattcgagactctcagctcctgaattattgtctcccagg
ccacagccggccagggaagaagccaacccacctctgagtgccagaaggagctga

DBGET integrated database retrieval system