KEGG   Sarcophilus harrisii (Tasmanian devil): 100929746Help
Entry
100929746         CDS       T02286                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 32-like
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100929746
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100929746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 982 aa AA seqDB search
VIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFSNESGSYVVREEMERMLHV
VDGKVPDTLRRCFSEGEKVNYEKFRNWLLQNKDAFTFSRWLLSGGVYVTLTDDSDTPTFY
QTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIHPSLSEGLFNAFDE
NHDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKD
NRTDDIPELHMNLSDIVEGILNAHDTTKKGHLTLEDYQIWSVKNVLANEFLNLLFQVCHI
VLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDSHPVVIEP
ASVLNGGKNSLSAAVHPMEQGDERMGGGLNYMSPTEEKLSDNISTASEASETAGNSFLYS
GTPGTDMCFARQHNTSDNNNQCLLGSNGNILLQLNPQKPGAIDNQPLVTQEPVKATSLTL
EGGRLKRAPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVRNVPSPNAPLKRVLAYTG
CFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHMLEYLKIQDEQHLVI
EVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ
YFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNG
FQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVV
DLFHGQLRSQVRCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRL
NMDEKYTGLKKQLSDLCGLKPEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPTP
GSPISASSPVQTDFSGSPTNGMLNISTSGDVVRPTLIPNGMPNTVVPCGIEKNFTNGILN
GHVTSFPDSPFIGYIIAIHRKM
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
gtgatatactgttcatttggtggaacatccaaagggctacactttaataatctgatagta
ggacttgttcttcttacaagagggagagatgaagagaaagcaaaatacatttttagtctt
ttttcaaatgaatctgggagttatgttgtacgggaagaaatggaaaggatgctccatgtc
gtggatggaaaagtcccagatacccttaggaggtgcttttcagagggtgaaaaagtcaac
tatgagaagtttagaaactggctgctacaaaataaagatgctttcactttttcccgatgg
ctgctgtctggaggtgtttatgttactctcactgatgatagtgatacccctactttctac
caaactctggctggagtcacacatttggaagaatcagacatcattgatcttgagaaacgc
tattggctgctgaaggctcaatcccggactggccgttttgatttagagacatttggccct
ttggtttcgccacccattcatccatctctgagtgaaggtttgtttaatgcctttgatgaa
aatcatgacaatcacatagactttaaagagatatcctgtgggttgtcagcatgttgcagg
ggacctctggctgaaagacaaaaattttgttttaaggtgttcgatgttgaccgtgatgga
gtcctctctcgagttgaactaagagatatggttgttgcactcttagaggtctggaaggac
aaccgtacggatgatatccctgaattgcacatgaatttgtcagatattgtagaaggtata
ttaaatgcacatgacaccacaaagaaggggcatcttactctggaagactatcagatctgg
agtgtaaagaatgttcttgccaatgagtttttaaatctcctttttcaggtgtgccatata
gtcctgggtttgagacctgctactccagaagaagaaggacaaatcattaggggctggtta
gaaagagagagcagatatggcttgcagccaggacacaactggtttatcatttctatgcag
tggtggcagcagtggaaagaatatgtcaaatatgattctcatcctgttgtgattgaacct
gcttctgttctgaacggagggaaaaattcactcagtgcagcagtacatcccatggaacag
ggagatgaaagaatgggtggaggtcttaattatatgagtcccacagaagagaagctgtcc
gacaatatttctactgcatcagaagcttcagagactgctggcaacagctttctatattct
ggtaccccagggactgatatgtgttttgctagacaacacaacacttcagacaataataat
cagtgtttacttggatccaatgggaacatcttactacaactcaatccacagaaaccaggg
gctattgataaccaacctttggtaactcaagaaccagtcaaggctacatctttaacacta
gaagggggacgattgaaacgagctccacagctgatccatggcagagattatgaaatggtt
ccagaacctgtatggagagcactttatcattggtatggcgccaatttggcccttcctaga
ccagtaaggaatgtgccttctccaaatgctcccttaaagcgggtgttagcttatacaggc
tgtttcagtaggatgcagaccatcaaagaaattcatgagtatctgtctcaaagattgcgc
atcaaggaagaagacatgcgcctgtggttatacaacagtgagaactaccttactcttctg
gatgatgaggaccacatgttagaatatctgaaaattcaggatgaacaacacttagttatt
gaagttcggaacaaagatatgagctggccagaagagatgtcatttatagcaaatagtagt
aagatagatagacacaaggttcccacagagaaaggagccactggcttaagtaatctggga
aacacatgttttatgaactccagcatccaatgtgtcagtaatacacagccattaactcaa
tatttcatctcagggagacatctttatgaactcaacaggaccaaccccattggaatgaag
ggtcacatggccaaatgttatggggacttagtgcaagaactgtggagtggaacacaaaag
aatgttgcccccctgaagcttcggtggacgatagcaaaatatgcccccaggtttaatggt
ttccagcagcaagactcccaggaacttctggcttttcttttggatggtcttcatgaagat
ctcaaccgagttcacgagaaaccatatgtagaactgaaggacagtgatggtcgtccagac
tgggaagtggctgcagaggcctgggataatcacctgagaaggaatcgatcgattgttgta
gatttattccatgggcagctaagatcccaagtcagatgcaaaacatgtgggcatataagt
gtccgatttgaccctttcaattttttgtctttgccactacctatggatagttacatgcac
ttagaaatcacagttatcaagttagatggtactactcctattcgatatgggctcaggcta
aacatggatgaaaagtacacaggattaaaaaagcaactgagtgacctctgtggacttaaa
ccagaacagattcttcttgcagaagtacatggttctaacataaagaactttcctcaggac
aaccaaaaggtacggctttcagtgagtggatttttatgtgcatttgagattcctacccct
ggatctcccatctcagcttcaagtccagtacaaacagatttctctggctcacctacaaat
ggaatgctgaatatatccaccagtggtgatgtggttcgaccaactcttattcccaatgga
atgccaaatactgttgtaccatgtggaattgagaagaacttcacaaatggaatactgaat
ggccatgtgacatcatttcctgatagtccttttataggttacatcattgcaatccacaga
aaaatg

DBGET integrated database retrieval system