KEGG   Sarcophilus harrisii (Tasmanian devil): 100929746Help
Entry
100929746         CDS       T02286                                 

Gene name
USP32
Definition
(RefSeq) ubiquitin specific peptidase 32
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100929746 (USP32)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100929746 (USP32)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100929746 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 997 aa AA seqDB search
VIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFSNESGSYVVREEMERMLHV
VDGKVPDTLRRCFSEGEKVNYEKFRNWLLQNKDAFTFSRWLLSGGVYVTLTDDSDTPTFY
QTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIHPSLSEGLFNAFDE
NHDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKD
NRTDDIPELHMNLSDIVEGILNAHDTTKKGHLTLEDYQIWSVKNVLANEFLNLLFQVCHI
VLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDSHPVVIEP
ASVLNGGKNSLSAAVHPMEQGDERMGGGLNYMSPTEEKLSDNISTASEASETAGNSFLYS
GTPGTDMCFARQHNTSDNNNQCLLGSNGNILLQLNPQKPGAIDNQPLVTQEPVKATSLTL
EGGRLKRAPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVKICSFSLRSYPLLSEGNV
PSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDH
MLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFM
NSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPL
KLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAA
EAWDNHLRRNRSIVVDLFHGQLRSQVRCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITV
IKLDGTTPIRYGLRLNMDEKYTGLKKQLSDLCGLKPEQILLAEVHGSNIKNFPQDNQKVR
LSVSGFLCAFEIPTPGSPISASSPVQTDFSGSPTNGMLNISTSGDVVRPTLIPNGMPNTV
VPCGIEKNFTNGILNGHVTSFPDSPFIGYIIAIHRKM
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
gtgatatactgttcatttggtggaacatccaaagggctacactttaataatctgatagta
ggacttgttcttcttacaagagggagagatgaagagaaagcaaaatacatttttagtctt
ttttcaaatgaatctgggagttatgttgtacgggaagaaatggaaaggatgctccatgtc
gtggatggaaaagtcccagatacccttaggaggtgcttttcagagggtgaaaaagtcaac
tatgagaagtttagaaactggctgctacaaaataaagatgctttcactttttcccgatgg
ctgctgtctggaggtgtttatgttactctcactgatgatagtgatacccctactttctac
caaactctggctggagtcacacatttggaagaatcagacatcattgatcttgagaaacgc
tattggctgctgaaggctcaatcccggactggccgttttgatttagagacatttggccct
ttggtttcgccacccattcatccatctctgagtgaaggtttgtttaatgcctttgatgaa
aatcatgacaatcacatagactttaaagagatatcctgtgggttgtcagcatgttgcagg
ggacctctggctgaaagacaaaaattttgttttaaggtgttcgatgttgaccgtgatgga
gtcctctctcgagttgaactaagagatatggttgttgcactcttagaggtctggaaggac
aaccgtacggatgatatccctgaattgcacatgaatttgtcagatattgtagaaggtata
ttaaatgcacatgacaccacaaagaaggggcatcttactctggaagactatcagatctgg
agtgtaaagaatgttcttgccaatgagtttttaaatctcctttttcaggtgtgccatata
gtcctgggtttgagacctgctactccagaagaagaaggacaaatcattaggggctggtta
gaaagagagagcagatatggcttgcagccaggacacaactggtttatcatttctatgcag
tggtggcagcagtggaaagaatatgtcaaatatgattctcatcctgttgtgattgaacct
gcttctgttctgaacggagggaaaaattcactcagtgcagcagtacatcccatggaacag
ggagatgaaagaatgggtggaggtcttaattatatgagtcccacagaagagaagctgtcc
gacaatatttctactgcatcagaagcttcagagactgctggcaacagctttctatattct
ggtaccccagggactgatatgtgttttgctagacaacacaacacttcagacaataataat
cagtgtttacttggatccaatgggaacatcttactacaactcaatccacagaaaccaggg
gctattgataaccaacctttggtaactcaagaaccagtcaaggctacatctttaacacta
gaagggggacgattgaaacgagctccacagctgatccatggcagagattatgaaatggtt
ccagaacctgtatggagagcactttatcattggtatggcgccaatttggcccttcctaga
ccagtaaagatttgctctttttctttaagaagttatcctttgctctctgaagggaatgtg
ccttctccaaatgctcccttaaagcgggtgttagcttatacaggctgtttcagtaggatg
cagaccatcaaagaaattcatgagtatctgtctcaaagattgcgcatcaaggaagaagac
atgcgcctgtggttatacaacagtgagaactaccttactcttctggatgatgaggaccac
atgttagaatatctgaaaattcaggatgaacaacacttagttattgaagttcggaacaaa
gatatgagctggccagaagagatgtcatttatagcaaatagtagtaagatagatagacac
aaggttcccacagagaaaggagccactggcttaagtaatctgggaaacacatgttttatg
aactccagcatccaatgtgtcagtaatacacagccattaactcaatatttcatctcaggg
agacatctttatgaactcaacaggaccaaccccattggaatgaagggtcacatggccaaa
tgttatggggacttagtgcaagaactgtggagtggaacacaaaagaatgttgcccccctg
aagcttcggtggacgatagcaaaatatgcccccaggtttaatggtttccagcagcaagac
tcccaggaacttctggcttttcttttggatggtcttcatgaagatctcaaccgagttcac
gagaaaccatatgtagaactgaaggacagtgatggtcgtccagactgggaagtggctgca
gaggcctgggataatcacctgagaaggaatcgatcgattgttgtagatttattccatggg
cagctaagatcccaagtcagatgcaaaacatgtgggcatataagtgtccgatttgaccct
ttcaattttttgtctttgccactacctatggatagttacatgcacttagaaatcacagtt
atcaagttagatggtactactcctattcgatatgggctcaggctaaacatggatgaaaag
tacacaggattaaaaaagcaactgagtgacctctgtggacttaaaccagaacagattctt
cttgcagaagtacatggttctaacataaagaactttcctcaggacaaccaaaaggtacgg
ctttcagtgagtggatttttatgtgcatttgagattcctacccctggatctcccatctca
gcttcaagtccagtacaaacagatttctctggctcacctacaaatggaatgctgaatata
tccaccagtggtgatgtggttcgaccaactcttattcccaatggaatgccaaatactgtt
gtaccatgtggaattgagaagaacttcacaaatggaatactgaatggccatgtgacatca
tttcctgatagtccttttataggttacatcattgcaatccacagaaaaatg

DBGET integrated database retrieval system