KEGG   Sarcophilus harrisii (Tasmanian devil): 100929811Help
Entry
100929811         CDS       T02286                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100929811
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100929811
   04015 Rap1 signaling pathway
    100929811
   04012 ErbB signaling pathway
    100929811
   04370 VEGF signaling pathway
    100929811
   04630 Jak-STAT signaling pathway
    100929811
   04668 TNF signaling pathway
    100929811
   04066 HIF-1 signaling pathway
    100929811
   04068 FoxO signaling pathway
    100929811
   04070 Phosphatidylinositol signaling system
    100929811
   04024 cAMP signaling pathway
    100929811
   04022 cGMP - PKG signaling pathway
    100929811
   04151 PI3K-Akt signaling pathway
    100929811
   04152 AMPK signaling pathway
    100929811
   04150 mTOR signaling pathway
    100929811
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100929811
  Cell growth and death
   04210 Apoptosis
    100929811
  Cellular commiunity
   04510 Focal adhesion
    100929811
   04550 Signaling pathways regulating pluripotency of stem cells
    100929811
 Organismal Systems
  Immune system
   04611 Platelet activation
    100929811
   04620 Toll-like receptor signaling pathway
    100929811
   04650 Natural killer cell mediated cytotoxicity
    100929811
   04660 T cell receptor signaling pathway
    100929811
   04662 B cell receptor signaling pathway
    100929811
   04664 Fc epsilon RI signaling pathway
    100929811
   04666 Fc gamma R-mediated phagocytosis
    100929811
   04670 Leukocyte transendothelial migration
    100929811
   04062 Chemokine signaling pathway
    100929811
  Endocrine system
   04910 Insulin signaling pathway
    100929811
   04915 Estrogen signaling pathway
    100929811
   04914 Progesterone-mediated oocyte maturation
    100929811
   04917 Prolactin signaling pathway
    100929811
   04921 Oxytocin signaling pathway
    100929811
   04919 Thyroid hormone signaling pathway
    100929811
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100929811
  Digestive system
   04973 Carbohydrate digestion and absorption
    100929811
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100929811
  Nervous system
   04725 Cholinergic synapse
    100929811
   04722 Neurotrophin signaling pathway
    100929811
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100929811
  Development
   04380 Osteoclast differentiation
    100929811
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100929811
   05205 Proteoglycans in cancer
    100929811
   05203 Viral carcinogenesis
    100929811
   05210 Colorectal cancer
    100929811
   05212 Pancreatic cancer
    100929811
   05214 Glioma
    100929811
   05221 Acute myeloid leukemia
    100929811
   05220 Chronic myeloid leukemia
    100929811
   05218 Melanoma
    100929811
   05211 Renal cell carcinoma
    100929811
   05215 Prostate cancer
    100929811
   05213 Endometrial cancer
    100929811
   05222 Small cell lung cancer
    100929811
   05223 Non-small cell lung cancer
    100929811
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100929811
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100929811
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100929811
   05166 HTLV-I infection
    100929811
   05162 Measles
    100929811
   05164 Influenza A
    100929811
   05161 Hepatitis B
    100929811
   05160 Hepatitis C
    100929811
   05169 Epstein-Barr virus infection
    100929811
   05146 Amoebiasis
    100929811
   05145 Toxoplasmosis
    100929811
   05142 Chagas disease (American trypanosomiasis)
    100929811
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100929811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 777 aa AA seqDB search
MLWKQAHNYPMFNLLMEIESYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKVITRNCD
PGEKLDSKIGVLIGKGLHEFDALEDPEVNEFRSKMRQFSEEKIQSLVGLSWIEWLKHTYP
PEQEPSIPENLEDKLYGGNLVIAVHFENCQDVFSFQVSPNMSPIKLNELVVRKRLTIHGK
EDEVDPYDYVLQVSGRLEFVFGDHPLIQFQYIRNCVMNRTLPKLTLVECCNIKKMFEQEM
IAIEAAINRNSSNLPLPLPPKKTRLISNVWDNTQPFQVILVKGTKLNTEESVKVHVRAGL
FHGTELLCKPVVSSEISGRNDHVWSEPLEFDINICDLPRMARLCFAVYAVDKVKTKKSTK
TINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKSGDIILHSWSSFPDELEEMLNPMGT
VQTNPYFENATTLHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSGNVSSRGGKKFHAVL
KEIMERDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIW
PKLPPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSR
FMLDRALANRRIGQFLFWHLRSEVHIPAFSVQFGVILEAYCRGSVGYMKVLSKQVEALNK
LKTLNSLIKLNAVKLNKAKGREAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKY
MDSKMKPLRIVYNNKVFGGDPLGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLR
NT seq 2330 nt NT seq  +upstreamnt  +downstreamnt
atgctatggaagcaagctcacaactaccctatgtttaaccttcttatggaaattgaatct
tatatgtttgcatgtgtgaatcaaactgctgtttatgaggagcttgaagatgaaacaaga
agactctgtgatgtcagaccttttcttccagttctcaaagtgataacaagaaattgtgac
ccaggggaaaaattagactccaaaattggagttcttataggaaaaggtctccatgagttt
gatgccctggaagatcctgaggtgaatgaattccgaagtaagatgcgccagttcagtgaa
gaaaagatccagtcccttgtgggattatcttggatagaatggttaaagcatacttaccca
ccagaacaagaaccttccattcctgaaaatttggaagataaactttatggtggaaatctt
gtgattgctgtccattttgaaaattgccaggatgtatttagtttccaagtatctcctaat
atgagtcccatcaaattaaatgagttggtagtccgaaaacggttgactatccacggaaag
gaagatgaagttgatccctatgactatgtgctgcaagtcagtgggagactagaatttgtg
ttcggtgatcaccctttaattcagttccagtatatccggaactgtgtcatgaatagaact
cttcccaaactcactcttgttgaatgttgcaatataaagaagatgtttgaacaggaaatg
attgccatagaagcggccataaatcgaaattcatccaaccttcctcttccactgcccccc
aaaaaaacacgattaatttctaatgtttgggataatactcagcctttccaagttatattg
gttaaaggaactaaactgaacacagaagaaagcgtcaaagttcatgtcagggctggactt
tttcatggaactgaacttctttgtaaaccagttgtaagctcagagatatctgggagaaat
gaccatgtttggagtgaaccactggaatttgatattaacatctgtgatttaccaagaatg
gctaggttatgctttgcagtttatgctgtggataaagtgaaaacaaaaaagtcaactaag
acaattaatccttccaaatatcagactatcaggaaagctggaaaagtgcactatcctgtg
gcatgggtaaacaccatggtgtttgacttcaaaggacagctgaaaagtggagacatcata
ttgcacagctggtcatcatttcctgacgaacttgaagaaatgttgaatccaatgggaact
gttcaaacaaatccatattttgaaaatgcaacaactttacatgttaaattccctgagaat
aaaaaacagccttattattaccctccttttgataagattattgaaaaggcagctgaaatt
gcaagtagtgacagtggtaatgtatctagtcgaggtgggaaaaaatttcatgctgtgctc
aaagaaatcatggagagggatcccttatcccaactatgtgagaatgaaatggatcttatt
tggactttgagacaagactgtagagaaaattttcctcagtcactgccaaaattgctgctg
tctgtcaaatggaacaaacttgaagatgttgctcagctacaggctcttcttcagatatgg
cctaaactgcctcctagagaagcattggaattattagactttaattatccagaccagtat
gtaagggagtatgcagtgggctgcttgaaacaaatgagtgatgaagaactatctcagtat
cttctacaacttgtacaagttttgaaatatgaaccttttcttgattgtgccctatctaga
tttatgttagacagagcacttgctaataggaggatagggcagtttctattttggcatctt
aggtcagaggtgcacattcctgccttttcagtgcagtttggtgtaatacttgaagcttac
tgtcgaggaagtgtgggctatatgaaagtgctttctaaacaggttgaagctcttaataag
ctgaagaccttaaatagtttaataaaattgaatgcagtaaagttaaacaaagcaaaagga
agagaagcaatgcatacatgcttaaaacaaaatgcttaccgagaagccctttctgatctt
cagtcacctttgaatccctgtgtcatcctttcagaactttatgttgaaaagtgcaagtac
atggattctaaaatgaagcctctgagaatagtatacaataacaaagtatttggaggagat
ccattgggtgtcatttttaaaaatggggatgatctacggcaagatatgttgactctccaa
atgttgcggttaatggatttactttggaaagaggctggattggatcttcg

DBGET integrated database retrieval system