KEGG   Sarcophilus harrisii (Tasmanian devil): 100929811Help
Entry
100929811         CDS       T02286                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  Jak-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04960  Aldosterone-regulated sodium reabsorption
shr04973  Carbohydrate digestion and absorption
shr05100  Bacterial invasion of epithelial cells
shr05142  Chagas disease (American trypanosomiasis)
shr05146  Amoebiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  HTLV-I infection
shr05167  Kaposi's sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05418  Fluid shear stress and atherosclerosis
Module
shr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100929811 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100929811 (PIK3CB)
   04015 Rap1 signaling pathway
    100929811 (PIK3CB)
   04012 ErbB signaling pathway
    100929811 (PIK3CB)
   04370 VEGF signaling pathway
    100929811 (PIK3CB)
   04630 Jak-STAT signaling pathway
    100929811 (PIK3CB)
   04668 TNF signaling pathway
    100929811 (PIK3CB)
   04066 HIF-1 signaling pathway
    100929811 (PIK3CB)
   04068 FoxO signaling pathway
    100929811 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100929811 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100929811 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100929811 (PIK3CB)
   04024 cAMP signaling pathway
    100929811 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100929811 (PIK3CB)
   04152 AMPK signaling pathway
    100929811 (PIK3CB)
   04150 mTOR signaling pathway
    100929811 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100929811 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    100929811 (PIK3CB)
   04218 Cellular senescence
    100929811 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100929811 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100929811 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100929811 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100929811 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100929811 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100929811 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100929811 (PIK3CB)
   04660 T cell receptor signaling pathway
    100929811 (PIK3CB)
   04662 B cell receptor signaling pathway
    100929811 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100929811 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100929811 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100929811 (PIK3CB)
   04062 Chemokine signaling pathway
    100929811 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100929811 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    100929811 (PIK3CB)
   04915 Estrogen signaling pathway
    100929811 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100929811 (PIK3CB)
   04917 Prolactin signaling pathway
    100929811 (PIK3CB)
   04926 Relaxin signaling pathway
    100929811 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100929811 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100929811 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100929811 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    100929811 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100929811 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100929811 (PIK3CB)
  Development
   04360 Axon guidance
    100929811 (PIK3CB)
   04380 Osteoclast differentiation
    100929811 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    100929811 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100929811 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100929811 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100929811 (PIK3CB)
   05231 Choline metabolism in cancer
    100929811 (PIK3CB)
   05205 Proteoglycans in cancer
    100929811 (PIK3CB)
   05203 Viral carcinogenesis
    100929811 (PIK3CB)
   05210 Colorectal cancer
    100929811 (PIK3CB)
   05212 Pancreatic cancer
    100929811 (PIK3CB)
   05225 Hepatocellular carcinoma
    100929811 (PIK3CB)
   05226 Gastric cancer
    100929811 (PIK3CB)
   05214 Glioma
    100929811 (PIK3CB)
   05221 Acute myeloid leukemia
    100929811 (PIK3CB)
   05220 Chronic myeloid leukemia
    100929811 (PIK3CB)
   05218 Melanoma
    100929811 (PIK3CB)
   05211 Renal cell carcinoma
    100929811 (PIK3CB)
   05215 Prostate cancer
    100929811 (PIK3CB)
   05213 Endometrial cancer
    100929811 (PIK3CB)
   05224 Breast cancer
    100929811 (PIK3CB)
   05222 Small cell lung cancer
    100929811 (PIK3CB)
   05223 Non-small cell lung cancer
    100929811 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100929811 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100929811 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100929811 (PIK3CB)
   04931 Insulin resistance
    100929811 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100929811 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100929811 (PIK3CB)
   05166 HTLV-I infection
    100929811 (PIK3CB)
   05162 Measles
    100929811 (PIK3CB)
   05164 Influenza A
    100929811 (PIK3CB)
   05161 Hepatitis B
    100929811 (PIK3CB)
   05160 Hepatitis C
    100929811 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100929811 (PIK3CB)
   05169 Epstein-Barr virus infection
    100929811 (PIK3CB)
   05165 Human papillomavirus infection
    100929811 (PIK3CB)
   05146 Amoebiasis
    100929811 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    100929811 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100929811 (PIK3CB)
   01524 Platinum drug resistance
    100929811 (PIK3CB)
   01522 Endocrine resistance
    100929811 (PIK3CB)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100929811 (PIK3CB)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100929811 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 RWD DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 100929811
NCBI-ProteinID: XP_003763784
Ensembl: ENSSHAG00000000088
Position
3
AA seq 1012 aa AA seqDB search
MLWKQAHNYPMFNLLMEIESYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKVITRNCD
PGEKLDSKIGVLIGKGLHEFDALEDPEVNEFRSKMRQFSEEKIQSLVGLSWIEWLKHTYP
PEQEPSIPENLEDKLYGGNLVIAVHFENCQDVFSFQVSPNMSPIKLNELVVRKRLTIHGK
EDEVDPYDYVLQVSGRLEFVFGDHPLIQFQYIRNCVMNRTLPKLTLVECCNIKKMFEQEM
IAIEAAINRNSSNLPLPLPPKKTRLISNVWDNTQPFQVILVKGTKLNTEESVKVHVRAGL
FHGTELLCKPVVSSEISGRNDHVWSEPLEFDINICDLPRMARLCFAVYAVDKVKTKKSTK
TINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKSGDIILHSWSSFPDELEEMLNPMGT
VQTNPYFENATTLHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSGNVSSRGGKKFHAVL
KEIMERDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIW
PKLPPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSR
FMLDRALANRRIGQFLFWHLRSEVHIPAFSVQFGVILEAYCRGSVGYMKVLSKQVEALNK
LKTLNSLIKLNAVKLNKAKGREAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKY
MDSKMKPLRIVYNNKVFGGDPLGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLP
YGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAI
EEFTLSCAGYCVASYVLGIGDRHSDNIMVRKTGQLFHIDFGHILGNFKSKFGIKRERVPF
ILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSV
KDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTMRKDYRS
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgctatggaagcaagctcacaactaccctatgtttaaccttcttatggaaattgaatct
tatatgtttgcatgtgtgaatcaaactgctgtttatgaggagcttgaagatgaaacaaga
agactctgtgatgtcagaccttttcttccagttctcaaagtgataacaagaaattgtgac
ccaggggaaaaattagactccaaaattggagttcttataggaaaaggtctccatgagttt
gatgccctggaagatcctgaggtgaatgaattccgaagtaagatgcgccagttcagtgaa
gaaaagatccagtcccttgtgggattatcttggatagaatggttaaagcatacttaccca
ccagaacaagaaccttccattcctgaaaatttggaagataaactttatggtggaaatctt
gtgattgctgtccattttgaaaattgccaggatgtatttagtttccaagtatctcctaat
atgagtcccatcaaattaaatgagttggtagtccgaaaacggttgactatccacggaaag
gaagatgaagttgatccctatgactatgtgctgcaagtcagtgggagactagaatttgtg
ttcggtgatcaccctttaattcagttccagtatatccggaactgtgtcatgaatagaact
cttcccaaactcactcttgttgaatgttgcaatataaagaagatgtttgaacaggaaatg
attgccatagaagcggccataaatcgaaattcatccaaccttcctcttccactgcccccc
aaaaaaacacgattaatttctaatgtttgggataatactcagcctttccaagttatattg
gttaaaggaactaaactgaacacagaagaaagcgtcaaagttcatgtcagggctggactt
tttcatggaactgaacttctttgtaaaccagttgtaagctcagagatatctgggagaaat
gaccatgtttggagtgaaccactggaatttgatattaacatctgtgatttaccaagaatg
gctaggttatgctttgcagtttatgctgtggataaagtgaaaacaaaaaagtcaactaag
acaattaatccttccaaatatcagactatcaggaaagctggaaaagtgcactatcctgtg
gcatgggtaaacaccatggtgtttgacttcaaaggacagctgaaaagtggagacatcata
ttgcacagctggtcatcatttcctgacgaacttgaagaaatgttgaatccaatgggaact
gttcaaacaaatccatattttgaaaatgcaacaactttacatgttaaattccctgagaat
aaaaaacagccttattattaccctccttttgataagattattgaaaaggcagctgaaatt
gcaagtagtgacagtggtaatgtatctagtcgaggtgggaaaaaatttcatgctgtgctc
aaagaaatcatggagagggatcccttatcccaactatgtgagaatgaaatggatcttatt
tggactttgagacaagactgtagagaaaattttcctcagtcactgccaaaattgctgctg
tctgtcaaatggaacaaacttgaagatgttgctcagctacaggctcttcttcagatatgg
cctaaactgcctcctagagaagcattggaattattagactttaattatccagaccagtat
gtaagggagtatgcagtgggctgcttgaaacaaatgagtgatgaagaactatctcagtat
cttctacaacttgtacaagttttgaaatatgaaccttttcttgattgtgccctatctaga
tttatgttagacagagcacttgctaataggaggatagggcagtttctattttggcatctt
aggtcagaggtgcacattcctgccttttcagtgcagtttggtgtaatacttgaagcttac
tgtcgaggaagtgtgggctatatgaaagtgctttctaaacaggttgaagctcttaataag
ctgaagaccttaaatagtttaataaaattgaatgcagtaaagttaaacaaagcaaaagga
agagaagcaatgcatacatgcttaaaacaaaatgcttaccgagaagccctttctgatctt
cagtcacctttgaatccctgtgtcatcctttcagaactttatgttgaaaagtgcaagtac
atggattctaaaatgaagcctctgagaatagtatacaataacaaagtatttggaggagat
ccattgggtgtcatttttaaaaatggggatgatctacggcaagatatgttgactctccaa
atgttgcggttaatggatttactttggaaagaggctggattggatcttcgaatgctccca
tatggttgtttagcaacaggagaccgttctggcctaattgaagttgtcagtacttctgaa
acaattgcagatattcagctaaatagtagtaatgttgctgctacagctgccttcaataaa
gatgctcttctaaactggcttaaagaatacaattcgggggatgacttagatcgagccatt
gaagagttcactctctcttgtgctggctactgtgtagcttcttatgtcttaggaattggt
gatagacatagtgacaatatcatggtcaggaagactggacagcttttccacattgatttt
ggacatattcttggaaacttcaaatctaaatttggcattaaacgggaacgagtgcctttc
attcttacctatgattttattcatgtcattcagcaaggaaaaacaggaaacacagaaaag
tttggccgatttcgtcagtgttgtgaagatgcttacttgattttacgaaggcatgggaat
ctctttatcactctgtttgctctgatgttgacagcaggacttcctgagctcacctccgtc
aaggatatacagtatcttaaggactctttggccttggggaagagtgaggaagaagcacta
aagcaatttaagcagaaatttgatgaagctctcagggaaagttggactactaaagtaaac
tggatggcacacaccatgaggaaagattaccggtcttaa

DBGET integrated database retrieval system