KEGG   Sarcophilus harrisii (Tasmanian devil): 100929864Help
Entry
100929864         CDS       T02286                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100929864 (CHRM4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100929864 (CHRM4)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100929864 (CHRM4)
G protein-coupled receptors [BR:shr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [Table]
    100929864 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 483 aa AA seqDB search
MANFTPVNGSYGNQSDQSVQAMPAAPNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIK
VNRQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNA
SVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGER
TVPDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKK
AKGLSFLRSPLMKQQSGKNPNRKPAEAAKEEIRNGRLEEAPPPVLLPPRPPEDKDTSNDS
SSASVTQNTRERPPTEGSTAETGCSPSTPLPPRPRALNPASKWSKIQIVTKQTGNECVTA
IEIVPATPAGLRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFIVTWTPY
NVMVLVNTFCQSCVPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFKHLLLCQYRNIG
TAR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcacccctgtcaacggcagctacggcaaccagtcggaccagtcggtgcag
gccatgccggcagcccccaaccgctacgagacggtggagatggtgttcatcgccacagtg
actggctcgctgagcctggttacggtcgtgggcaacattctggtcatgctctccatcaag
gtcaaccggcagctgcagacggtcaacaactacttcctgttcagcctggcctgcgccgac
ctcatcattggggccttctccatgaacctctacaccgtgtacatcatcaagggctactgg
cccctgggggccgtggtctgcgacctgtggctggctctggactacgtggtcagcaacgcc
tcggtgatgaacctgctcatcatcagcttcgaccgctacttctgtgtgaccaagcccctg
acctaccccgcgcggcgcaccaccaagatggcgggcctcatgatcgccgccgcctgggtg
ctgtcctttgtgctctgggccccggccatcctcttctggcagtttgtggtgggtgagcgg
acggtgccggacaatcagtgcttcatccagttcctgtccaacccagcggtcaccttcggc
acggccatcgcggccttctacctgcccgtggtcatcatgaccgtgctctacatccacatc
tccctggccagtcgcagccgggtccacaagcaccgccccgaggggcccaaggagaaaaag
gccaagggcctctccttcctccgcagccccctcatgaagcagcagagcggcaagaacccg
aaccggaagccggcggaggccgccaaggaagagatccgcaacgggaggctggaggaagcc
cctcccccggtcctgctcccaccccggccccccgaggacaaggacacgtccaacgactcc
agctcggccagcgtcacccagaacaccagggagaggccccccaccgagggctcgacggcc
gagaccggctgcagcccgtccaccccgctgcccccacgcccccgggcgctcaacccggcc
tccaagtggtccaagatacagatcgtcacgaagcagacgggcaacgagtgtgtgacggcc
atcgagatcgtccccgccacgccggccggcctgcgcccggccgccaacgtggcccgcaag
ttcgccagcatcgcccgcaaccaggtgaggaagaagcggcagatggcggcgcgggagagg
aaggtgacgcggaccatcttcgccatcttgctggccttcatcgtcacctggacgccctac
aacgtcatggtgctggtcaacaccttctgccagagctgcgtccccgacaccgtctggtcc
atcggctactggctctgctacgtcaacagcaccatcaaccccgcctgctacgccctctgc
aacgccaccttcaagaagaccttcaagcacttgctcctgtgccagtacagaaacattggt
actgccaggtaa

DBGET integrated database retrieval system