KEGG   Sarcophilus harrisii (Tasmanian devil): 100929956Help
Entry
100929956         CDS       T02286                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100929956 (EIF3J)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100929956 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 240 aa AA seqDB search
MASVLATSWNLRWTSEEESSLVKGSAALIPEENWDDDDEEKKEETEVKPETKVSEKKKIA
EKIKEKERQQKKRQEEIKKRLEEPEESKELTPEEQLADKLRLKKLQEEADLELAKETFGV
NNTVCGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKK
ITNSLTVLCSEKQKQEKQNKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDFEDFM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgtgcttgctacatcttggaacctcaggtggacatcagaggaggaaagcagc
cttgtgaaaggctcagcagccctcatcccagaggaaaactgggatgatgatgatgaagaa
aaaaaagaggagacagaggtaaaaccagaaacaaaagtttcagaaaagaagaaaatagca
gagaaaatcaaagagaaagaacggcaacagaagaaaagacaagaagaaattaagaaaagg
ttggaagagcctgaagaatctaaagagcttacaccagaagaacaattagcagataaacta
cggctaaagaaattgcaggaagaggcagaccttgaattagcaaaagaaacctttggtgtt
aataacacagtctgtggtatagatgccatgaacccctcttcaagagatgacttcacagaa
tttggcaagttactaaaagataaaattacacagtatgaaaaatctctatattatgccagt
ttcttggaagcattagttcgagatgtgtgtatttcattggaaattgatgatttgaaaaag
attactaattcattgacagtgctatgcagtgaaaaacagaaacaagaaaagcaaaacaaa
gccaaaaagaagaagaaaggtgtggttcctggagggggattaaaggctacaatgaaagat
gatcttgcagactatggtggctatgatggaggatatgtgcaagactttgaagacttcatg
tga

DBGET integrated database retrieval system