KEGG   Sarcophilus harrisii (Tasmanian devil): 100929956Help
Entry
100929956         CDS       T02286                                 

Gene name
EIF3J
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100929956 (EIF3J)
Ribosome biogenesis [BR:shr03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100929956 (EIF3J)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100929956 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit DUF5093
Motif
Other DBs
NCBI-GeneID: 100929956
NCBI-ProteinID: XP_023356745
Ensembl: ENSSHAG00000016772
Position
1
AA seq 253 aa AA seqDB search
MAAAAGDSDSWDADTFSVEEPVRKAGGAAGGDRWEGEDEDDDVKENWDDDDEEKKEETEV
KPETKVSEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKELTPEEQLADKLRLKKLQE
EADLELAKETFGVNNTVCGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVR
DVCISLEIDDLKKITNSLTVLCSEKQKQEKQNKAKKKKKGVVPGGGLKATMKDDLADYGG
YDGGYVQDFEDFM
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggggactcggactcctgggacgcggacacgttctcggtggaggag
ccggtgcggaaggcggggggcgcggccggcggggaccgctgggagggtgaggatgaggat
gacgacgtcaaggaaaactgggatgatgatgatgaagaaaaaaaagaggagacagaggta
aaaccagaaacaaaagtttcagaaaagaagaaaatagcagagaaaatcaaagagaaagaa
cggcaacagaagaaaagacaagaagaaattaagaaaaggttggaagagcctgaagaatct
aaagagcttacaccagaagaacaattagcagataaactacggctaaagaaattgcaggaa
gaggcagaccttgaattagcaaaagaaacctttggtgttaataacacagtctgtggtata
gatgccatgaacccctcttcaagagatgacttcacagaatttggcaagttactaaaagat
aaaattacacagtatgaaaaatctctatattatgccagtttcttggaagcattagttcga
gatgtgtgtatttcattggaaattgatgatttgaaaaagattactaattcattgacagtg
ctatgcagtgaaaaacagaaacaagaaaagcaaaacaaagccaaaaagaagaagaaaggt
gtggttcctggagggggattaaaggctacaatgaaagatgatcttgcagactatggtggc
tatgatggaggatatgtgcaagactttgaagacttcatgtga

DBGET integrated database retrieval system