KEGG   Sarcophilus harrisii (Tasmanian devil): 100930182Help
Entry
100930182         CDS       T02286                                 

Gene name
CAD
Definition
(RefSeq) CAD protein
  KO
K11540  carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00240  Pyrimidine metabolism
shr00250  Alanine, aspartate and glutamate metabolism
shr01100  Metabolic pathways
Module
shr_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100930182 (CAD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100930182 (CAD)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     100930182 (CAD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     100930182 (CAD)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     100930182 (CAD)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   100930182 (CAD)
 Metallo Peptidases
  Family M38: beta-aspartyl dipeptidase family
   100930182 (CAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 CPSase_sm_chain OTCace_N GATase CPSase_L_D3 OTCace ATP-grasp Dala_Dala_lig_C MGS ATPgrasp_Ter Amidohydro_1 RimK ATP-grasp_3 Peptidase_C26 GARS_A GSH-S_ATP Ish1
Motif
Other DBs
NCBI-GeneID: 100930182
NCBI-ProteinID: XP_023357284
Ensembl: ENSSHAG00000012598
Position
4
AA seq 2220 aa AA seqDB search
MAALVLEDGSVLRGQPFGAALSAAGEXVFQTGMVGYPEALTDPSYKAQILVLTYPLVGNY
GIPPDEKDEFSLSQWFESSGIHVAGLVVGECCSTPSHWSATRTLHQWLEEHGIPGLQGVD
TRELTKKLREQGSLLGKLVQDGIEPSSLPFLDPNARALVPEVSIKEPKVYNAGGCPKILA
LDCGLKYSQIRCLCQRGAEVTVVPWDYKLDSQDYEGLFLSNGPGDPASCPTVISTLSRVL
SEPNPRPIFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLKGSGRCFLTSQNHGFAVE
TDSLPPGWTPLFTNANDHSNEGIVHETLPFFSVQFHPEHRAGPSDMELLFDIFLETVKEN
RAGGKTVHERLMERLCPSGTPTPRDRPPFPRKVLILGSGGLSIGQAGEFDYSGSQAIKAL
KEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALN
CGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEYVAPSEAANSLEQAQA
AAERLGYPVLVRAAFALGGLGSGFASSREELSSLIAPAFAHTSQVLVDKSLKGWKEIEYE
VVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVG
ECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGISLPELRNSVT
GGTAAFEPSLDYCVVKVPRWDLSKFLRVSTQIGSCMKSVGEVMAIGRGFEEAFQKALRMV
DENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYTIDRLYELTRIDRWFLQCMKRI
IEHTRKLEGHRGRPLPSDVLHQAKRLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQI
DTVAAEWPAQTNYLYLTYGGTTHDLTFHTPHVLVLGSGVYRIGSSVEFDWCAVGCIRQLR
KMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELESPEGVILSMGGQLPNNM
AMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGY
PCVVRPSYVLSGAAMNVAYSDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACD
GMVVAVAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQL
IAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEEVEPVGLMTGTGVVGVKV
PQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYK
NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVEGECPPQRSILEQ
LAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQI
GPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAM
PNTRPPIIDAPALALAQKLAETGARCDYALFLGASSENAGTLGAVAGAAAGLKLYLNETF
SELRLDSLANWMEHFETWPRHLPIVAHAERQTVAAILMVAQLAQRPVHICHVARKEEILL
IKAAKARGVPVTCEVAPHHLFLSQTDLERLGPGKGEVRPELGSPEDVEALWENMAVIDCF
ASDHAPHTLEEKTGSKAPPGFPGLETMLPLLLTAVSEGRLSLDDLLQKLHHNPRRIFHLP
PQEDTYIEVDLEHEWTIPSYMPFSKAHWTPFEGQRVKGTIRRVVLRGEVAYIDGQVLVPP
GYGQDVRKWPQGAVPQLLPSAPPSENTKTPERPRRVIPGLPEGRFHLPPRIHRASDPGLP
AEEPKEKPSRKAVEPDLAGTPDSCCYPPPVPRQASPQNLGAPSLLHPQTSPLLHSLVGQH
ILSVRQFTKDQMSHLFNVAHTLRMMVQKERSIDILKGKVMASMFYEVSTRTSSSFAAAMA
RLGGSVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINA
GDGVGEHPTQALLDVFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA
PPSLRMPHDVLSFVASKGTKQEEFESIEEALPDTDVLYMTRIQKERFGSSQEYEACFGQF
ILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYMRMALLATVLGRY
NT seq 6663 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctagtactggaggacgggtcggtcctgcggggccagcccttcggcgcggcc
ttaagcgccgccggggaancagtgttccagactggcatggtgggctaccccgaggcgctc
accgacccctcctacaaagcgcagatcttggtcctgacctatccgctcgtgggcaactac
ggcatccctccggacgagaaggacgagttcagcctcagccagtggtttgagtcatccgga
attcatgtggcgggactggtggtgggagaatgctgctccacacctagtcactggagtgcc
acccgaactttgcaccaatggctagaggagcatggcatacctggtcttcaaggagttgat
acaagagaactgacaaagaagttgcgggaacagggatcacttctgggaaagctggtgcaa
gatgggatagagccttcatctctgccatttttggatcccaatgctcgagctcttgtacct
gaggtttccattaaggaaccaaaggtatacaatgcaggggggtgcccaaagattcttgcc
ctggattgtggcctaaaatacagtcagatccgatgcctatgccaacgtggagctgaggtc
actgtggtgccctgggactacaaattggacagccaagattatgaagggttgtttctaagc
aatggtcctggggatcctgcttcttgccccactgtgatatctacactgagccgtgtcctc
tctgagccaaacccccgacctatctttggtatctgcttgggtcatcagttgttggcctta
gccatcggggccaagacttacaagatgagatatggtaaccgtggccacaaccagccatgt
ctgctgaagggctctggacgatgcttcttaacttcccagaatcatggctttgcagtggaa
acagactctctgcctccaggctggaccccactcttcacaaatgccaatgatcattccaat
gaaggcattgtacacgagaccctgcccttcttcagcgtccagttccatcctgagcaccga
gcaggcccctctgatatggagttgctttttgacatcttcctggagaccgtgaaggagaac
agggctgggggcaagacagttcatgaaaggctaatggagcgactttgtccctctggtacc
cccaccccgagagacagacctccatttccccgaaaggtgctgatcctgggctcagggggt
ctctccattggccaggctggagagtttgactattctggctctcaggcaatcaaggctcta
aaggaggaaaatattcaaacactgctaatcaaccctaatattgccacagtgcaaacttcc
cagggcctggcagacaaagtctacttcttgcctattacccctcattacgtgacccaggtg
attcgtaacgagcgtccagatggtgtgttactgacctttggaggccagacagcactgaat
tgtggtgtggagctcacaaaagcaggggttctggcccgatatggagtacgggtcctagga
acccctgtggagacaattgagctgactgaggatcggcgtgcttttgcagcaagaatggca
gagattggagaatatgtggccccgagtgaggctgcaaactccctggagcaggcacaagct
gctgcggagcgactggggtaccctgtcctggtgcgtgccgcctttgccctaggcggcctc
ggctctggctttgcctccagcagagaagagctctcctccctgatagccccagcctttgct
cataccagccaagtgctggtggacaagtccctcaaaggatggaaagaaattgagtatgaa
gtggtgagagatgcctacggcaactgtgtcacggtctgtaacatggagaacttagatcca
ctgggcattcacactggtgaatccatagttgtggccccaagccagaccctaaatgacagg
gaataccagctgttgcgacaaactgctatcaaggtgacccagcatttgggcattgttggg
gagtgcaatgtacaatatgccttgaatcctgagtctgaacagtactatatcattgaagtg
aatgcacgactgtctcgaagttcagctcttgccagtaaggccactggctatcctttggct
tatgtagcagccaagctggctttgggcatctccctgcctgaactcaggaactcagttact
ggaggcacagctgcctttgagcccagcctggattactgcgtggttaaggttcctcgctgg
gacctcagcaagttcctacgtgttagcacacagattggaagctgcatgaagagtgttggt
gaggtcatggctattggacgtgggttcgaggaggcattccagaaggcattacgcatggtg
gatgagaattgtgttggctttgatcacacggtgaagcctgtcagtgacatggagctggag
acaccaactgataagcggatctttgtagtggcagctgctctgtgggcaggatacaccata
gaccgactctatgagctcactcgcattgatcggtggttccttcagtgtatgaagcgcatt
atagagcacacccggaaactagaaggacaccgtgggcggcccttgccctctgatgtgttg
caccaggccaaacgccttggcttctctgacaagcagattgctcttgcagtgctcagcaca
gagttggctgtccgaaaactacggcaggaactgggtatctgtccggcagtaaaacagatt
gatacagtggcggcagaatggccagctcagactaactatctgtacctgacttatgggggt
accacccatgacctgactttccatactcctcatgtcttggtcctgggctctggcgtctac
cgaattggctccagcgttgaatttgattggtgtgctgtgggctgcatccggcagctgcgc
aagatggggtataagaccatcatggtgaactacaatcctgagacagtcagtaccgactat
gatatgtgtgaccgactctactttgatgagatctcttttgaggtggtgatggatatctat
gagttggaaagccctgagggtgtgatcctctccatggggggtcagctgcccaacaacatg
gcgatggctctgcatcggcagcagtgtcgggttcttgggacctccccggaggccattgac
tctgctgagaaccgattcaagttttctcgattgcttgataccattggcatcagtcagcct
cagtggcgagagcttagtgacttggagtctgcccgccagttctgccagactgtggggtat
ccttgtgttgtccgtccttcttatgtgctgagtggtgctgccatgaatgtggcctattcc
gatggagacctggagcgcttcctgagcagtgcagctgctgtctccaaagagcaccctgtg
gtcatctccaagttcatccaggaggccaaggaaatcgatgtggatgctgtagcttgtgat
ggtatggtagtagctgtcgcaatctcggagcacgtggaaaatgcaggggtgcactcaggg
gatgccacgttggtgactccaccacaagatatcacacccaagacactggaaaggatcaaa
gcaattgttcatgctgtgggtcaagaattgcaggtcacagggcctttcaacctgcagctc
attgccaaggatgaccaactcaaggttattgagtgcaacgtccgtgtctctcggtccttc
ccctttgtctccaagacacttggagtggatctggtggccctggctacccggatcatcatg
ggtgaggaggtggagcctgttgggctcatgactggaaccggtgttgtaggagttaaggtg
cctcagttctcattctcccgcctggcaggagcagatgtggtgctgggggtagagatgacc
agcacaggggaggtggctggctttggagagagccgctgtgaggcctaccttaaggctatg
ctaagcacgggcttcaagatccccaaaaagaatattctgctaactattggtagttacaag
aacaagagtgagctgctccccactgtgaggctgctggagagtctaggctatagcttatat
gccagtttgggcaccgcagacttctacactgagcatggtgtcaaggtcacagctgtggac
tggcactttgaggaagcagttgaaggtgaatgtcccccacagcgaagcattctggaacag
ctggcagaaaaccactttgagttggtgatcaacctgtcaatgcgtggagcaggggggcgg
cgtctgtcctccttcgttaccaagggctaccggacccgtcgccttgctgctgacttttct
gtgcccctcatcatcgacatcaaatgcactaagctgtttgtagaggcattgggccagatc
gggccagctcccccactgaaggttcatgtagattgcatgacctcacagaagctggtgcgt
ttgccagggctaattgatgtacatgtgcacctacgggaaccaggtggtacccacaaagag
gactttgcatcaggcacagcagctgctttagctgggggggtcacaatggtgtgtgccatg
cccaacactcggcctcccatcatagatgccccagcacttgcccttgctcagaagttggca
gagactggggcccgctgtgattatgccttgttccttggggcctcatcagagaatgcagga
accctgggtgctgtggctggggcagctgcaggattgaaactctatctcaatgaaacattc
tccgaacttcgcctggacagccttgccaattggatggagcactttgagacttggccacgt
catcttcctattgtggctcatgcagaacgacagactgttgctgccatcctcatggttgcc
cagctggctcaacggcctgtacacatctgccatgtggcccggaaggaggagatcctatta
attaaagcagcaaaggcacggggggtaccagtgacttgtgaagtggccccccaccatctg
tttctaagccaaactgaccttgagcgcctggggcctgggaaaggagaagtccggcctgag
cttggctcccctgaggatgtggaggctctctgggaaaacatggccgtcattgattgcttt
gcctctgaccatgctcctcacaccctggaagaaaaaacaggatccaaggctccccctggc
ttccctggcctggagacgatgctcccgctgttgctgacagctgtgagtgagggccgtctc
agcctggatgatctgctgcagaagctacaccacaaccctcggagaatctttcacttgccc
ccacaggaggacacctacattgaggtggatctggagcatgaatggaccatccccagctac
atgcctttttccaaggcacactggacaccttttgaggggcagcgagtgaagggcaccatt
cggcgagttgtccttcgaggggaagttgcctatattgatggccaggtgctggtgcctcct
ggttatgggcaagatgtgaggaagtggccccaaggtgcagtgcctcaactgctgccctct
gctccacccagtgagaataccaagactcctgaaaggcctcgacgtgtcatcccaggcctt
cctgaggggcgcttccatctcccacctcgaatccaccgagcttctgatcctggccttcca
gctgaagagcccaaggaaaagccatcccggaaggccgtggagccagatctagcaggaact
cctgatagttgctgctatcctcctccagtgcctaggcaggcgtcgccccaaaatctgggt
gcgcccagcctgttacatcctcagacctcacccttgctgcattctctagttgggcagcat
atactgtccgttcgtcagtttaccaaagatcagatgtcccacctgttcaacgtggctcac
accctacggatgatggtgcagaaggaacgaagcatagacattctcaagggcaaggtgatg
gcctccatgttttatgaagtgagcactcgtaccagcagctcctttgcagccgccatggcc
cgtcttgggggctctgtgctcagcttctctgaagccacatcatctgtccagaagggggaa
tccctagcagactctgtccagaccatgagctgctatgctgatgtcgttgtgctccggcac
ccccagcctggagctgtggagctagcagcaaagcactgccggaggccggtgatcaatgct
ggggatggagtaggggaacacccaacgcaggccttgctggatgtctttaccattcgagag
gaactgggaactgtcaacggcatgacgatcacgatggtaggggatctcaagcacgggcgg
acggtgcattctctggcctgcctgctcacccagtaccgggtcagccttcgctacgtggca
ccccccagcctgcgcatgccgcacgacgtcttgtcttttgtggcgtccaaagggactaag
caggaggaatttgagagcatcgaggaggcactgcctgacacagatgttctttacatgact
cggattcagaaggaacggtttggctccagccaggaatatgaagcttgcttcggccagttt
atcctcacgccccacatcatgacacgggcaaagaagaagatggtggtgatgcacccaatg
cctcgagtcaatgagatcagtgtggaagtggactccgacccccgggctgcctacttccgg
caagctgagaatggcatgtatatgcggatggccctccttgctactgtactggggcgatac
tag

DBGET integrated database retrieval system