KEGG   Sarcophilus harrisii (Tasmanian devil): 100930270Help
Entry
100930270         CDS       T02286                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 497 aa AA seqDB search
MPHPRRYRSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSYDE
HSSDRRAYDRRYCGSYRRDYSRERGEPYYEAEYRHSYEYHRDDSYRSQRSSRRKHRRRRR
HSRTFSHSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDH
RRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISF
ELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDY
ELTYNLEKKRDERSVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWTQPCD
VWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDE
NTSAGRYVRENCKPLRRYLTSEADEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLR
AEPPSAKVWDSSRDISR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccccgaagataccgttcttcagagcggggcagccggggcagctaccatgaa
cactaccgcagtcgaaaacataagcgtaggagaagccgttcttggtccagcagcagtgac
cggactcggcggcgccggcgagaagacagctatcatgtccgttctaggagctatgatgag
cattcttctgacaggcgggcttatgatcgacgctactgtggcagctacaggcgtgactac
agccgggagcgaggggaaccttactatgaagctgagtatcgacattcttatgagtaccat
cgggatgacagctatcgtagtcagcgcagtagccgtaggaaacacaggcggcgaagacga
catagccggacattcagccattcatcttcgcagcacagcagccggagagccaagagtgtg
gaggacgacgctgagggtcacctcatctaccacgtcggggactggctacaagagcgatat
gagattgtgagcactctaggagaggggacctttggccgagttgtacagtgtgtggatcat
agaaggggtggagctcgggttgccctaaagatcattaagaatgtggaaaagtacaaagaa
gcagcacgattggaaatcaatgttctggagaagatcaacgaaaaggacccagacaataag
aacctgtgtgtccagatgtttgactggtttgactaccatggccacatgtgtatctccttc
gagctcctgggcctcagcactttcgacttcctcaaagacaacaactacctgccctacccc
atccaccaagtgcgccacatggcattccagctgtgtcaggccgtcaagttcctccatgac
aacaagctgacacatacggacctcaagccagaaaacatcctgtttgtgaattcggattat
gaactcacctacaacctggagaagaaacgggatgaacggagtgtgaagaatacagcagta
cgggtagtggattttggcagtgccacttttgaccatgaacaccatagcaccattgtctcc
actcgacattaccgagctccggaggtcatcttggagctcggctggactcagccctgtgac
gtgtggagcatcggctgcatcatctttgagtactacgttggcttcaccttgttccagact
catgacaaccgagaacacttggccatgatggagaggatcctggggcccattccctctcga
atgatcagaaaaaccaggaagcagaagtatttttaccggggtcgactggattgggatgag
aacacatcggctggccgttatgtgcgagagaattgcaaacctctgcggcgatacctgaca
tcagaggcagatgaacaccaccagctatttgacctgattgagagcatgctagaatatgaa
cctgccaagcgactgaccctgggcgaagcccttcaacatcctttctttgcccgccttagg
gctgaaccgccaagcgctaaggtgtgggactccagtcgggatatcagccggtga

DBGET integrated database retrieval system