KEGG   Sarcophilus harrisii (Tasmanian devil): 100930270Help
Entry
100930270         CDS       T02286                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100930270 (CLK2)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100930270 (CLK2)
Spliceosome [BR:shr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100930270 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 497 aa AA seqDB search
MPHPRRYRSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSYDE
HSSDRRAYDRRYCGSYRRDYSRERGEPYYEAEYRHSYEYHRDDSYRSQRSSRRKHRRRRR
HSRTFSHSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDH
RRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISF
ELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDY
ELTYNLEKKRDERSVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWTQPCD
VWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDE
NTSAGRYVRENCKPLRRYLTSEADEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLR
AEPPSAKVWDSSRDISR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccccgaagataccgttcttcagagcggggcagccggggcagctaccatgaa
cactaccgcagtcgaaaacataagcgtaggagaagccgttcttggtccagcagcagtgac
cggactcggcggcgccggcgagaagacagctatcatgtccgttctaggagctatgatgag
cattcttctgacaggcgggcttatgatcgacgctactgtggcagctacaggcgtgactac
agccgggagcgaggggaaccttactatgaagctgagtatcgacattcttatgagtaccat
cgggatgacagctatcgtagtcagcgcagtagccgtaggaaacacaggcggcgaagacga
catagccggacattcagccattcatcttcgcagcacagcagccggagagccaagagtgtg
gaggacgacgctgagggtcacctcatctaccacgtcggggactggctacaagagcgatat
gagattgtgagcactctaggagaggggacctttggccgagttgtacagtgtgtggatcat
agaaggggtggagctcgggttgccctaaagatcattaagaatgtggaaaagtacaaagaa
gcagcacgattggaaatcaatgttctggagaagatcaacgaaaaggacccagacaataag
aacctgtgtgtccagatgtttgactggtttgactaccatggccacatgtgtatctccttc
gagctcctgggcctcagcactttcgacttcctcaaagacaacaactacctgccctacccc
atccaccaagtgcgccacatggcattccagctgtgtcaggccgtcaagttcctccatgac
aacaagctgacacatacggacctcaagccagaaaacatcctgtttgtgaattcggattat
gaactcacctacaacctggagaagaaacgggatgaacggagtgtgaagaatacagcagta
cgggtagtggattttggcagtgccacttttgaccatgaacaccatagcaccattgtctcc
actcgacattaccgagctccggaggtcatcttggagctcggctggactcagccctgtgac
gtgtggagcatcggctgcatcatctttgagtactacgttggcttcaccttgttccagact
catgacaaccgagaacacttggccatgatggagaggatcctggggcccattccctctcga
atgatcagaaaaaccaggaagcagaagtatttttaccggggtcgactggattgggatgag
aacacatcggctggccgttatgtgcgagagaattgcaaacctctgcggcgatacctgaca
tcagaggcagatgaacaccaccagctatttgacctgattgagagcatgctagaatatgaa
cctgccaagcgactgaccctgggcgaagcccttcaacatcctttctttgcccgccttagg
gctgaaccgccaagcgctaaggtgtgggactccagtcgggatatcagccggtga

DBGET integrated database retrieval system