KEGG   Sarcophilus harrisii (Tasmanian devil): 100930326Help
Entry
100930326         CDS       T02286                                 

Gene name
BCKDK
Definition
branched chain ketoacid dehydrogenase kinase
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100930326 (BCKDK)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100930326 (BCKDK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 410 aa AA seqDB search
MLLASVLGSGPRGGSPLWPLASPALRFWSTSATDTHHMELARERSKTVTSFYNQSAIDAA
AEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLHHELPVRIAHRIKGFRSLPFIIGCNPTI
LHVHELYIRAFQKLSEFAPIKDQASEAQYCQLVRQLLDDHKDVVTLLAEGLRECRKHIQD
EKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLC
EHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDIVITI
ANNDIDLIIRISDRGGGIAHHHLDKVMDYHFTTAEASTQDPRISPLFGHLDTNSNGQSGP
MHGFGFGLPTSRAYAEYLGGSLRLQSLQGIGTDVYLRLRHIDGKEESFRI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgctcttagcatcagtgctggggagtggcccccgtgggggttccccactctggccactg
gcttccccggctcttcgattctggtctacttcggccactgacacccatcacatggaactg
gccagagagcgatccaagactgtcacctctttctacaaccagtcagccattgatgctgca
gctgagaagccttctgtccgtcttactccaaccatgatgttgtactcaggccgttcccag
gatggcagccacctgctgaaaagtgcccgttacctacaccacgagctccctgttcgtata
gctcatcgtatcaagggcttccgaagtctgcctttcatcattggctgcaatcctaccatt
ctccatgtgcatgaactctatatccgagccttccaaaagctgagtgaatttgccccgata
aaggaccaggcatctgaggctcagtattgccagttggtccgtcaactcctagatgatcac
aaagatgtggtaactcttctggctgagggacttcgagagtgccggaagcatatccaggat
gagaaactggtccgatatttcttggacaagacactgacgtcacggctgggaatccgtatg
ttggccacccatcacctggctctgcatgaggacaagcccgactttgtggggatcatctgt
actcgactctctccaaagaagatcattgagaagtgggtggactttgccaggaggctgtgt
gaacacaagtatggaaatgcccctcgagttcggatcaatggccatgtggctgcccggttc
cccttcatcccaatgcccctggactacattcttcctgagctgctgaagaatgctatgagg
gccacaatggagagccatctagacactccatacaatgtcccggatattgtcatcactatt
gccaacaatgatatcgaccttattatcagaatttcagatcggggtgggggcatcgctcac
caccacttggacaaagtgatggattaccatttcactacggctgaagccagcactcaggat
ccccgaatcagtccgctttttggtcacctggatacaaacagcaatggccagtcaggacct
atgcatgggtttggttttggtcttcctacatccagggcctatgcagaatacttaggtggt
tcccttcgcctccagtccttgcaagggatcggcacagatgtctacctacgacttcggcat
attgatggcaaggaagagagcttccggatctga

DBGET integrated database retrieval system