KEGG   Sarcophilus harrisii (Tasmanian devil): 100930371Help
Entry
100930371         CDS       T02286                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100930371
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100930371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 273 aa AA seqDB search
MAKLLASPMGSLEESLPGLQKFPCCLSNIAQDFLEEELRLNAELDKLQFSEPVGFIYNPL
KYALELHQNYVTKYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGIVGTVLTPP
EEHPKRRILGLQCPQSEVSGARFWGFFRALCGQPETFFRHCFVHNLCPLLFLAPSGRNLT
PADLPAKQREQLLGACDTALRRQVQLLGVRLVVGVGRLAEQRARRALADIVPEVQVEGLL
HPSPRSPQANRGWEAVARERLKELGLMPLLTVE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctactggcctccccaatgggctccctagaggaatctttacccggtttgcag
aagtttccctgctgtctttccaacatagcccaggatttcctggaggaagaattgagactg
aatgctgaactggacaagctacagttctcagagcctgtgggctttatttataatcccttg
aaatatgccttggagcttcatcagaactatgtcaccaaatactgccaaggtcccaaggaa
gtgctgtttttgggcatgaatccagggccctttggcatggcccagactggggtgcctttt
ggggaagtatctgtggtccgggactggttgggcattgtggggacagtgttaaccccaccc
gaggaacaccccaagcggcgaatcttggggctgcagtgcccccagtcagaggtgagcggt
gctcgcttttggggctttttccgtgccctctgtgggcaacctgagaccttcttcagacac
tgctttgtccacaatctatgccctcttcttttcttggccccttctgggcgcaatctcacc
cctgcggatctgcctgccaaacagagggagcagctcctgggagcctgtgacactgctctt
cgacgccaggtgcaacttctgggtgttcgcctggtggtaggagtggggcggctggcagaa
caacgggctcgccgagcactggcagacattgtgcctgaggttcaggtggaagggctcctg
cacccttctcctcgaagcccacaggccaaccggggatgggaggctgtggccagagaacgg
ctgaaggagttgggcctcatgcctctgctgacagttgaatga

DBGET integrated database retrieval system