KEGG   Sarcophilus harrisii (Tasmanian devil): 100930371Help
Entry
100930371         CDS       T02286                                 

Gene name
SMUG1
Definition
(RefSeq) single-strand-selective monofunctional uracil-DNA glycosylase 1
  KO
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100930371 (SMUG1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100930371 (SMUG1)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     100930371 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 308 aa AA seqDB search
MTGGWGVWVIPKARRRKMLRKQARMGVLGEDGDSSMAKLLASPMGSLEESLPGLQKFPCC
LSNIAQDFLEEELRLNAELDKLQFSEPVGFIYNPLKYALELHQNYVTKYCQGPKEVLFLG
MNPGPFGMAQTGVPFGEVSVVRDWLGIVGTVLTPPEEHPKRRILGLQCPQSEVSGARFWG
FFRALCGQPETFFRHCFVHNLCPLLFLAPSGRNLTPADLPAKQREQLLGACDTALRRQVQ
LLGVRLVVGVGRLAEQRARRALADIVPEVQVEGLLHPSPRSPQANRGWEAVARERLKELG
LMPLLTVE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaggatggggagtatgggtcatccccaaagcacggagacggaagatgctgagg
aagcaggccaggatgggggtgcttggggaggacggtgatagtagcatggccaagctactg
gcctccccaatgggctccctagaggaatctttacccggtttgcagaagtttccctgctgt
ctttccaacatagcccaggatttcctggaggaagaattgagactgaatgctgaactggac
aagctacagttctcagagcctgtgggctttatttataatcccttgaaatatgccttggag
cttcatcagaactatgtcaccaaatactgccaaggtcccaaggaagtgctgtttttgggc
atgaatccagggccctttggcatggcccagactggggtgccttttggggaagtatctgtg
gtccgggactggttgggcattgtggggacagtgttaaccccacccgaggaacaccccaag
cggcgaatcttggggctgcagtgcccccagtcagaggtgagcggtgctcgcttttggggc
tttttccgtgccctctgtgggcaacctgagaccttcttcagacactgctttgtccacaat
ctatgccctcttcttttcttggccccttctgggcgcaatctcacccctgcggatctgcct
gccaaacagagggagcagctcctgggagcctgtgacactgctcttcgacgccaggtgcaa
cttctgggtgttcgcctggtggtaggagtggggcggctggcagaacaacgggctcgccga
gcactggcagacattgtgcctgaggttcaggtggaagggctcctgcacccttctcctcga
agcccacaggccaaccggggatgggaggctgtggccagagaacggctgaaggagttgggc
ctcatgcctctgctgacagttgaatga

DBGET integrated database retrieval system