KEGG   Sarcophilus harrisii (Tasmanian devil): 100930591Help
Entry
100930591         CDS       T02286                                 

Definition
calcineurin B homologous protein 2-like
Orthology
K17611  
calcineurin B homologous protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100930591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 282 aa AA seqDB search
MLGAVRNTKIFLGNSCIGPSVGWPALETPIGIYYCGSGHWLQNGDSKTGVIGVGSSHRYR
CPLRDSGSLSPQSQTWHSLVPESGTGSLEPLPGSRAPQQRLMSPPSHSPVSLANLNRLHH
RFRDLDRNHKGYLSRMDLHNIKELEMNPLGDRIINSFFPDGGQCVDFRGFVRVLAHFRPL
EEEDPVRDPQKPEPLNSRNNKLRFAFQLYDLDCDGKISKKEMLQVLRLMVGVEVTDEQLE
VIADRTVQEADLDGDGAVSFVEFAKSLEKMNVEHKMSIRILK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcttggtgctgtcaggaacaccaagatcttcctaggcaacagctgtatagggccttct
gtgggttggcctgcattggagacaccaattgggatctactattgtggaagtgggcactgg
ctacagaatggggattctaagactggggtcattggtgtaggatcttcccatcgatatcgg
tgcccccttcgggactccgggtctctgagtcctcagtcccaaacctggcactctctggtc
cccgagtcaggaactgggagccttgagcctctccccggctcccgagccccccagcagcgg
ctgatgtctcccccttcccactctccagtctctctggccaacctcaatcgcctccatcac
cgcttccgggacttggacaggaatcacaagggttacctaagccggatggatctgcacaac
ataaaagaactggaaatgaatcctctaggggatcgcatcatcaacagctttttcccagat
gggggtcagtgtgtggatttccgaggctttgtccgggtcctggcccactttcgaccattg
gaagaagaggatcccgttagggacccccagaagcctgagcctctaaacagtcggaacaac
aaactgcgttttgcttttcagctctatgacctggactgtgatggaaagatctcaaagaaa
gagatgttacaggtcttgaggttgatggtgggggtggaggtgacggatgagcagctggaa
gtcattgcagaccgcacagtacaagaagccgatttggacggggacggagccgtgtccttt
gtggagtttgccaagtccttagagaagatgaacgtggaacacaaaatgagcatccggatc
ctgaagtga

DBGET integrated database retrieval system