KEGG   Sarcophilus harrisii (Tasmanian devil): 100930697Help
Entry
100930697         CDS       T02286                                 

Gene name
AGMAT
Definition
(RefSeq) agmatinase, mitochondrial
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00330  Arginine and proline metabolism
shr01100  Metabolic pathways
Module
shr_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100930697 (AGMAT)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100930697 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100930697
NCBI-ProteinID: XP_003765128
Ensembl: ENSSHAG00000009265
UniProt: G3W5P0
Position
3
AA seq 390 aa AA seqDB search
MEQLFSYHVRKLLQASLWKDGLQLGASSGPGRRRWSGVCRRPLIGTFPVLPWACSAPRLF
RGLLQLSDIPSRWASGAACNMPPSSEFVARSVGVCTMMRLPLKSSPEGLDAAFVGVPLDI
GTSNRPGTRFGPRRIREESVLLRTINPSTGALPFQSHLVADIGDVNVNLYNLQDSCRLIR
EAYQKIAAANCIPLTLGGDHTITYPILQALAGKHGPVGLLHVDAHTDTADKALGEKLYHG
TPFRRCVEEGLLDCKRVVQIGIRGSSAILNPYKYSRDQGFRVVLAEDCWLKSLVPLMGEV
RQQMGKKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVA
PMYDPSGNTALLAANLLFEMLCVLPKVKTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctcttttcctatcatgtccgcaaacttctccaagccagtttgtggaaggat
ggactccagctgggggcttcctcaggacctggccggcgacgatggtcgggggtctgccga
aggcctttgattgggacatttcccgtgctcccgtgggcctgttctgctcccaggcttttt
aggggcctcctccaactgtcagatatcccaagccgatgggcctcgggtgctgcatgtaac
atgcctcccagctccgagtttgttgcccgctcagtgggcgtctgcactatgatgagacta
cccctgaagagctcccccgaagggctggatgcagcatttgtgggagttcccctagacatt
ggcacttctaatcgacctggaacaaggtttggaccacgacgtatccgggaggaatctgtg
ttgctgagaacaattaacccaagcacaggggctctccccttccagtcccacttggtggcc
gacattggtgatgtgaatgtcaacctctacaatcttcaggacagctgccggctcattcga
gaagcctatcagaaaatcgctgcagcaaactgtatacctcttaccttgggcggagatcac
acaatcacttatcccatactgcaggcactggcaggaaagcacggtcctgttgggctgtta
cacgtcgatgcccacacagacacagccgacaaagccttgggagagaagctctaccacggg
accccttttcgccgctgtgtggaggaaggactcctggactgcaaacgcgtggtgcagata
ggcatccgggggtcttctgcaatcctgaatccctacaaatacagccgagaccagggcttc
cgggtggtcctggctgaagactgctggctgaagtcgctggttccgttgatgggggaagtg
aggcagcagatgggaaagaagcctatttatatcagttttgatatcgatgccttggatcca
gcctatgctccggggacagggactcctgagattgctggtctcacaccaagtcaagccttg
gagattatccgcggatgtcaaggcctgaacgtggtgggctgtgacctcgtggaagtcgca
cccatgtatgatccttccggaaacacagctctcctggcagccaatctgctgttcgagatg
ctgtgtgttctccccaaagtgaaaactgcctaa

DBGET integrated database retrieval system