KEGG   Sarcophilus harrisii (Tasmanian devil): 100930697Help
Entry
100930697         CDS       T02286                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:shr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 390 aa AA seqDB search
MEQLFSYHVRKLLQASLWKDGLQLGASSGPGRRRWSGVCRRPLIGTFPVLPWACSAPRLF
RGLLQLSDIPSRWASGAACNMPPSSEFVARSVGVCTMMRLPLKSSPEGLDAAFVGVPLDI
GTSNRPGTRFGPRRIREESVLLRTINPSTGALPFQSHLVADIGDVNVNLYNLQDSCRLIR
EAYQKIAAANCIPLTLGGDHTITYPILQALAGKHGPVGLLHVDAHTDTADKALGEKLYHG
TPFRRCVEEGLLDCKRVVQIGIRGSSAILNPYKYSRDQGFRVVLAEDCWLKSLVPLMGEV
RQQMGKKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVA
PMYDPSGNTALLAANLLFEMLCVLPKVKTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctcttttcctatcatgtccgcaaacttctccaagccagtttgtggaaggat
ggactccagctgggggcttcctcaggacctggccggcgacgatggtcgggggtctgccga
aggcctttgattgggacatttcccgtgctcccgtgggcctgttctgctcccaggcttttt
aggggcctcctccaactgtcagatatcccaagccgatgggcctcgggtgctgcatgtaac
atgcctcccagctccgagtttgttgcccgctcagtgggcgtctgcactatgatgagacta
cccctgaagagctcccccgaagggctggatgcagcatttgtgggagttcccctagacatt
ggcacttctaatcgacctggaacaaggtttggaccacgacgtatccgggaggaatctgtg
ttgctgagaacaattaacccaagcacaggggctctccccttccagtcccacttggtggcc
gacattggtgatgtgaatgtcaacctctacaatcttcaggacagctgccggctcattcga
gaagcctatcagaaaatcgctgcagcaaactgtatacctcttaccttgggcggagatcac
acaatcacttatcccatactgcaggcactggcaggaaagcacggtcctgttgggctgtta
cacgtcgatgcccacacagacacagccgacaaagccttgggagagaagctctaccacggg
accccttttcgccgctgtgtggaggaaggactcctggactgcaaacgcgtggtgcagata
ggcatccgggggtcttctgcaatcctgaatccctacaaatacagccgagaccagggcttc
cgggtggtcctggctgaagactgctggctgaagtcgctggttccgttgatgggggaagtg
aggcagcagatgggaaagaagcctatttatatcagttttgatatcgatgccttggatcca
gcctatgctccggggacagggactcctgagattgctggtctcacaccaagtcaagccttg
gagattatccgcggatgtcaaggcctgaacgtggtgggctgtgacctcgtggaagtcgca
cccatgtatgatccttccggaaacacagctctcctggcagccaatctgctgttcgagatg
ctgtgtgttctccccaaagtgaaaactgcctaa

DBGET integrated database retrieval system