KEGG   Sarcophilus harrisii (Tasmanian devil): 100930840Help
Entry
100930840         CDS       T02286                                 

Gene name
MOS
Definition
(RefSeq) proto-oncogene serine/threonine-protein kinase mos
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04114  Oocyte meiosis
shr04810  Regulation of actin cytoskeleton
shr04914  Progesterone-mediated oocyte maturation
Module
shr_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100930840 (MOS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100930840 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100930840 (MOS)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100930840 (MOS)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: Other
  MOS family
   100930840 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100930840
NCBI-ProteinID: XP_003759821
Ensembl: ENSSHAG00000010971
Position
2
AA seq 352 aa AA seqDB search
MPSPVPLPRFFPREFSPSVDLRPCSSPLELPRKGGKLFLEGTPSPRARRLPRRLAWCSID
WEQIRFLQKLGAGGFGSVYKGTYRGLTVAIKQVKKCSKNRLASRQSFWAELNVARLCHKN
VVRVVAASTCTPAGYDSLGTIIMEYGGHTTLHDVIYGASSATDDEEPGVGELSDLGRCLQ
YSLDVVSGLLFLHSQGIVHLDLKPANIFIGEHEICKIGDFGCSQRLEDLLGLSAHHCHLG
GTYTHRAPEILKGEAVTGKADVYSFAITLWQMVTKEVPYSGEHQYILYAVVAYNLRPPLT
SPVFADSIPGPRLEHIIRRCWTADTLLRPSSELLLGDLNSLHANLAGLNARS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaccagttcccctgcctcgtttctttcccagagaattttctccttcagtggat
ttgcggccctgcagcagccctctggagctcccaaggaagggggggaagctatttttagag
ggaactccctccccaagggctcgacggctaccccggagactggcctggtgctccatagac
tgggaacagatacgtttcctgcagaagctgggggccggggggtttggctccgtctataag
ggcacctaccgagggcttaccgtcgccataaagcaagtgaagaagtgcagcaagaaccgg
ctggcttcgcgacaaagcttctgggccgagctcaacgtggcccggctgtgccacaaaaat
gtggtgcgggttgtagccgccagcacttgcactcctgcgggctacgacagcctggggacc
atcatcatggagtatggtggccacacgaccctgcacgacgtcatctacggggctagctca
gcaaccgacgatgaggagcccggagtcggggagctctcggacctgggaagatgcctccag
tattcgctcgacgtggtcagtggtctgcttttcctccactctcaaggcatcgtccacttg
gatctgaagccggccaacatctttatcggggagcatgaaatctgcaaaattggggacttc
gggtgttcccaaaggctggaagatctgctgggcttgagcgcccaccattgccatctgggc
ggcacatacacacatcgggccccggagatcctcaaaggagaggcggtgactggcaaagca
gacgtctattcctttgccatcacgctctggcaaatggtcacaaaggaggtgccttattca
ggtgagcaccagtacatcctgtatgcggtggtggcctataacctccggccaccgctcaca
tccccggtcttcgccgactccatacctggcccaagactggaacacattatccgacgctgc
tggactgctgacactttgctcagacccagctcagaactgctcctgggtgatctcaattcc
ttgcacgctaacttggcaggcttgaatgctagaagttaa

DBGET integrated database retrieval system