KEGG   Sarcophilus harrisii (Tasmanian devil): 100930840Help
Entry
100930840         CDS       T02286                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:shr04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:shr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:shr04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 352 aa AA seqDB search
MPSPVPLPRFFPREFSPSVDLRPCSSPLELPRKGGKLFLEGTPSPRARRLPRRLAWCSID
WEQIRFLQKLGAGGFGSVYKGTYRGLTVAIKQVKKCSKNRLASRQSFWAELNVARLCHKN
VVRVVAASTCTPAGYDSLGTIIMEYGGHTTLHDVIYGASSATDDEEPGVGELSDLGRCLQ
YSLDVVSGLLFLHSQGIVHLDLKPANIFIGEHEICKIGDFGCSQRLEDLLGLSAHHCHLG
GTYTHRAPEILKGEAVTGKADVYSFAITLWQMVTKEVPYSGEHQYILYAVVAYNLRPPLT
SPVFADSIPGPRLEHIIRRCWTADTLLRPSSELLLGDLNSLHANLAGLNARS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaccagttcccctgcctcgtttctttcccagagaattttctccttcagtggat
ttgcggccctgcagcagccctctggagctcccaaggaagggggggaagctatttttagag
ggaactccctccccaagggctcgacggctaccccggagactggcctggtgctccatagac
tgggaacagatacgtttcctgcagaagctgggggccggggggtttggctccgtctataag
ggcacctaccgagggcttaccgtcgccataaagcaagtgaagaagtgcagcaagaaccgg
ctggcttcgcgacaaagcttctgggccgagctcaacgtggcccggctgtgccacaaaaat
gtggtgcgggttgtagccgccagcacttgcactcctgcgggctacgacagcctggggacc
atcatcatggagtatggtggccacacgaccctgcacgacgtcatctacggggctagctca
gcaaccgacgatgaggagcccggagtcggggagctctcggacctgggaagatgcctccag
tattcgctcgacgtggtcagtggtctgcttttcctccactctcaaggcatcgtccacttg
gatctgaagccggccaacatctttatcggggagcatgaaatctgcaaaattggggacttc
gggtgttcccaaaggctggaagatctgctgggcttgagcgcccaccattgccatctgggc
ggcacatacacacatcgggccccggagatcctcaaaggagaggcggtgactggcaaagca
gacgtctattcctttgccatcacgctctggcaaatggtcacaaaggaggtgccttattca
ggtgagcaccagtacatcctgtatgcggtggtggcctataacctccggccaccgctcaca
tccccggtcttcgccgactccatacctggcccaagactggaacacattatccgacgctgc
tggactgctgacactttgctcagacccagctcagaactgctcctgggtgatctcaattcc
ttgcacgctaacttggcaggcttgaatgctagaagttaa

DBGET integrated database retrieval system