KEGG   Sarcophilus harrisii (Tasmanian devil): 100930840Help
Entry
100930840         CDS       T02286                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100930840 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100930840 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    100930840 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100930840 (MOS)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100930840 (MOS)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100930840 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 352 aa AA seqDB search
MPSPVPLPRFFPREFSPSVDLRPCSSPLELPRKGGKLFLEGTPSPRARRLPRRLAWCSID
WEQIRFLQKLGAGGFGSVYKGTYRGLTVAIKQVKKCSKNRLASRQSFWAELNVARLCHKN
VVRVVAASTCTPAGYDSLGTIIMEYGGHTTLHDVIYGASSATDDEEPGVGELSDLGRCLQ
YSLDVVSGLLFLHSQGIVHLDLKPANIFIGEHEICKIGDFGCSQRLEDLLGLSAHHCHLG
GTYTHRAPEILKGEAVTGKADVYSFAITLWQMVTKEVPYSGEHQYILYAVVAYNLRPPLT
SPVFADSIPGPRLEHIIRRCWTADTLLRPSSELLLGDLNSLHANLAGLNARS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaccagttcccctgcctcgtttctttcccagagaattttctccttcagtggat
ttgcggccctgcagcagccctctggagctcccaaggaagggggggaagctatttttagag
ggaactccctccccaagggctcgacggctaccccggagactggcctggtgctccatagac
tgggaacagatacgtttcctgcagaagctgggggccggggggtttggctccgtctataag
ggcacctaccgagggcttaccgtcgccataaagcaagtgaagaagtgcagcaagaaccgg
ctggcttcgcgacaaagcttctgggccgagctcaacgtggcccggctgtgccacaaaaat
gtggtgcgggttgtagccgccagcacttgcactcctgcgggctacgacagcctggggacc
atcatcatggagtatggtggccacacgaccctgcacgacgtcatctacggggctagctca
gcaaccgacgatgaggagcccggagtcggggagctctcggacctgggaagatgcctccag
tattcgctcgacgtggtcagtggtctgcttttcctccactctcaaggcatcgtccacttg
gatctgaagccggccaacatctttatcggggagcatgaaatctgcaaaattggggacttc
gggtgttcccaaaggctggaagatctgctgggcttgagcgcccaccattgccatctgggc
ggcacatacacacatcgggccccggagatcctcaaaggagaggcggtgactggcaaagca
gacgtctattcctttgccatcacgctctggcaaatggtcacaaaggaggtgccttattca
ggtgagcaccagtacatcctgtatgcggtggtggcctataacctccggccaccgctcaca
tccccggtcttcgccgactccatacctggcccaagactggaacacattatccgacgctgc
tggactgctgacactttgctcagacccagctcagaactgctcctgggtgatctcaattcc
ttgcacgctaacttggcaggcttgaatgctagaagttaa

DBGET integrated database retrieval system