KEGG   Sarcophilus harrisii (Tasmanian devil): 100930970Help
Entry
100930970         CDS       T02286                                 

Gene name
RPTOR
Definition
(RefSeq) LOW QUALITY PROTEIN: regulatory-associated protein of mTOR
  KO
K07204  regulatory associated protein of mTOR
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04136  Autophagy - other
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04714  Thermogenesis
shr04910  Insulin signaling pathway
shr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100930970 (RPTOR)
   04152 AMPK signaling pathway
    100930970 (RPTOR)
   04150 mTOR signaling pathway
    100930970 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100930970 (RPTOR)
   04136 Autophagy - other eukaryotes
    100930970 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100930970 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100930970 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100930970 (RPTOR)
  Environmental adaptation
   04714 Thermogenesis
    100930970 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100930970 (RPTOR)
Membrane trafficking [BR:shr04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100930970 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 WD40 Cnd1 Hyccin
Motif
Other DBs
NCBI-GeneID: 100930970
NCBI-ProteinID: XP_023358415
Ensembl: ENSSHAG00000008522
Position
4
AA seq 1060 aa AA seqDB search
MQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQ
DLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEE
GTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDL
GPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFL
SVLADPYMPAEHRTMTAFILAVIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAI
CLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSTERTDHSTT
IDHNVAMMLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYPLPSPAA
TEGGSLTPVRDGPCTPRLRSVSSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNL
STSSSASSTLGSPENEEYILSFETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLA
ADPYPDVSDLAMKVLNSIAYKATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPP
TSSTSSSSLTNDVTKQPGSRDIPSGRPANVGAMGVQYTPHSHQFPRTRKMFDKGPDQTTD
DADDTVGHKSFISATMQTGFCDWSAKYFAQPVMKVTEDYSGDSKXRKEREWNLIRCIEIQ
ISYQILSSPFLFVGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGE
KLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADVEKNPEMVTAWQGL
SDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCD
SHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAHLQKHPEGHIMSVSVNGD
VRFFDPRMPESVNVLQIVKGLTALDIHPQANLFACGSMNQFTAIYNGNGELINNIKYYDG
FMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRIR
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtgtgtcagtctggtgcctggagtcacactggatttaatagagaagattcct
ggcaggctcaatgacaggaggactcctctaggagaactgaactggatcttcactgcaatt
acagataccattgcttggaatgtgctgcccagggatctcttccaaaagcttttcagacag
gatctcttggtggcaagtctgtttcgtaactttctgttggcagaaaggatcatgagatca
tataactgtacccccgttagcagtcctcgcctacctcctacctatatgcatgcaatgtgg
caagcttgggacctagcagttgatatttgtctctcccaattgccaaccattatagaggaa
ggaactgcatttaggcacagcccattctttgctgagcagttgactgcattccaggtgtgg
ctcacaatgggagtagagaacagaaatccaccagaacagcttcccatagtcttacaggtg
ctgttaagccaagttcatcggttgagagctctcgacttactgggaaggtttttagacttg
ggcccctgggcagtgagcctggctctatcagttggcatcttcccatatgtgctgaaactg
ctacagagctcagccagagaactgagaccacttcttgttttcatatgggccaaaattcta
gctgtggacagttcatgccaagctgatctcgtgaaggacaacggtcacaaatatttcctt
tctgtcttggcagacccttatatgccagctgaacataggaccatgacagctttcattctg
gctgtgattgtcaacagctataacacaggacaggaagcttgtcttcaaggcaacctgatt
gccatttgtctggagcaactgaatgaccctcaccctttgttgcgtcaatgggtggccatc
tgcctgggacgaatttggcaaaattttgattcagcaagatggtgtggtgtaagagacagt
gcccatgagaaactctacagtcttctctctgatcccattcctgaagttcgttgtgctgca
gtttttgcccttggcacttttgtgggtaactctacagagaggactgatcactccaccaca
attgatcacaatgtggctatgatgctagctcagcttatcaatgacggaagccctatggtt
agaaaggaactggtggtagctctgagtcatcttgtggttcagtatgagagtaatttctgc
acagtagccttgcaatttattgaagaagaaaagaactaccctctgccttctccagctgcc
acagaggggggaagtttgacacctgtgcgagatggtccatgtacacctagacttcgttca
gtcagctcctatggaaatattagagcagttaccacagcaagaagtttgaacaagtctttg
cagaatctgagcttgacagaagaatctggaagctctgttgcattttctccaggcaatctc
agcaccagtagcagtgcaagcagcaccctgggcagccctgaaaacgaagagtacatcctt
tcatttgagacaatcgataagatgagaagagtcagctcttactcctcactaaactcactt
ataggagtttccttcaatagtgtttacacacaaatttggagagtcctactacatctggct
gctgacccatatccagatgtttcagatttggctatgaaagtgctcaacagcatcgcctat
aaggccactgtcaatgcccgtcctcaacgcatccttgacacttcttctcttactcagtct
gccccagctagccctaccaacaagggcatgcacattcatcaagtgggaggctcccctcca
acatccagtaccagcagctccagcctgactaatgatgtgactaagcagccaggcagtcgg
gacatcccatcaggaagaccagctaatgtgggtgccatgggtgtacagtatacacctcac
tcccaccaattccccaggacacgaaaaatgtttgacaagggcccagatcagaccactgat
gatgcagatgacactgttggacacaaaagtttcatttcagccacaatgcagacaggattc
tgtgactggagtgccaaatattttgcccagccagtaatgaaggtaactgaagattattca
ggggatagcaagtaaagaaaggaaagggaatggaatttgatcagatgcatagaaattcag
attagttaccaaatactttcttctccatttctttttgtaggtattacaagactagatgat
cagatcttccttaataggaatcctggtgttccttcagtggtcaaattccatcccttcact
ccttgcatagctgtagctgataaagacagcatttgtttttgggactgggaaaaaggggaa
aagttggactactttcacaatggaaatcctcgctatacaagagtcactgccatggagtat
ctgaatggccaggattgttcgttgctactgacagccacagatgacggtgccatcagggtg
tggaaaaattttgcagatgtagaaaagaaccctgaaatggtgactgcctggcaggggctt
tcagacatgctaccaacaacaagaggagctggtatggtagtagactgggaacaagagact
ggtctcctcatgacatcaggagatgtacggattatccgaatctgggacacagatagagag
atgaaagtgcaggatatccccactggtgcagacagctgtgtgacaagcctctcctgtgac
tctcaccgctcactcattgtggctggccttggcgacggttccattcgggtctatgatagg
agaatggcactcagtgaatgccgagttatgacctaccgtgagcatactgcctgggtggtg
aaagcacacctccagaaacatcccgagggccacatcatgagcgtcagtgtcaatggagat
gtacgtttcttcgacccccggatgcctgaatctgtgaatgtcctccaaatagtgaaagga
ttaacggcccttgacattcacccacaggcaaatttgtttgcatgtggctcaatgaatcaa
ttcactgctatctacaatgggaatggagagctgatcaacaacatcaaatactatgatggg
tttatgggacaaagagttggagccatcagctgtttagctttccacccgcactggcctcat
ttggcagttggaagcaatgactactacatttcggtgtactccgtggagaagcgcatcaga
taa

DBGET integrated database retrieval system