KEGG   Sarcophilus harrisii (Tasmanian devil): 100930970Help
Entry
100930970         CDS       T02286                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway - mammal
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100930970 (RPTOR)
   04152 AMPK signaling pathway
    100930970 (RPTOR)
   04150 mTOR signaling pathway
    100930970 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100930970 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100930970 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100930970 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100930970 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 961 aa AA seqDB search
MRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAF
QVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYV
LKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTA
FILAVIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGV
RDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSTERTDHSTTIDHNVAMMLAQLINDGS
PMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYPLPSPAATEGGSLTPVRDGPCTPR
LRSVSSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEE
YILSFETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNS
IAYKATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPPTSSTSSSSLTNDVTKQP
GSRDIPSGRPANVGAMGVQYTPHSHQFPRTRKMFDKGPDQTTDDADDTVGHKSFISATMQ
TGFCDWSAKYFAQPVMKARELKDMNYIGFRLMCLSITRLDDQIFLNRNPGVPSVVKFHPF
TPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIR
VWKNFADVEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDTDR
EMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWV
VKAHLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDIHPQANLFACGSMN
QFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRI
R
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatataactgtacccccgttagcagtcctcgcctacctcctacctatatgcat
gcaatgtggcaagcttgggacctagcagttgatatttgtctctcccaattgccaaccatt
atagaggaaggaactgcatttaggcacagcccattctttgctgagcagttgactgcattc
caggtgtggctcacaatgggagtagagaacagaaatccaccagaacagcttcccatagtc
ttacaggtgctgttaagccaagttcatcggttgagagctctcgacttactgggaaggttt
ttagacttgggcccctgggcagtgagcctggctctatcagttggcatcttcccatatgtg
ctgaaactgctacagagctcagccagagaactgagaccacttcttgttttcatatgggcc
aaaattctagctgtggacagttcatgccaagctgatctcgtgaaggacaacggtcacaaa
tatttcctttctgtcttggcagacccttatatgccagctgaacataggaccatgacagct
ttcattctggctgtgattgtcaacagctataacacaggacaggaagcttgtcttcaaggc
aacctgattgccatttgtctggagcaactgaatgaccctcaccctttgttgcgtcaatgg
gtggccatctgcctgggacgaatttggcaaaattttgattcagcaagatggtgtggtgta
agagacagtgcccatgagaaactctacagtcttctctctgatcccattcctgaagttcgt
tgtgctgcagtttttgcccttggcacttttgtgggtaactctacagagaggactgatcac
tccaccacaattgatcacaatgtggctatgatgctagctcagcttatcaatgacggaagc
cctatggttagaaaggaactggtggtagctctgagtcatcttgtggttcagtatgagagt
aatttctgcacagtagccttgcaatttattgaagaagaaaagaactaccctctgccttct
ccagctgccacagaggggggaagtttgacacctgtgcgagatggtccatgtacacctaga
cttcgttcagtcagctcctatggaaatattagagcagttaccacagcaagaagtttgaac
aagtctttgcagaatctgagcttgacagaagaatctggaagctctgttgcattttctcca
ggcaatctcagcaccagtagcagtgcaagcagcaccctgggcagccctgaaaacgaagag
tacatcctttcatttgagacaatcgataagatgagaagagtcagctcttactcctcacta
aactcacttataggagtttccttcaatagtgtttacacacaaatttggagagtcctacta
catctggctgctgacccatatccagatgtttcagatttggctatgaaagtgctcaacagc
atcgcctataaggccactgtcaatgcccgtcctcaacgcatccttgacacttcttctctt
actcagtctgccccagctagccctaccaacaagggcatgcacattcatcaagtgggaggc
tcccctccaacatccagtaccagcagctccagcctgactaatgatgtgactaagcagcca
ggcagtcgggacatcccatcaggaagaccagctaatgtgggtgccatgggtgtacagtat
acacctcactcccaccaattccccaggacacgaaaaatgtttgacaagggcccagatcag
accactgatgatgcagatgacactgttggacacaaaagtttcatttcagccacaatgcag
acaggattctgtgactggagtgccaaatattttgcccagccagtaatgaaggcaagagag
ttaaaggatatgaattatattggctttcgactgatgtgtctcagtattacaagactagat
gatcagatcttccttaataggaatcctggtgttccttcagtggtcaaattccatcccttc
actccttgcatagctgtagctgataaagacagcatttgtttttgggactgggaaaaaggg
gaaaagttggactactttcacaatggaaatcctcgctatacaagagtcactgccatggag
tatctgaatggccaggattgttcgttgctactgacagccacagatgacggtgccatcagg
gtgtggaaaaattttgcagatgtagaaaagaaccctgaaatggtgactgcctggcagggg
ctttcagacatgctaccaacaacaagaggagctggtatggtagtagactgggaacaagag
actggtctcctcatgacatcaggagatgtacggattatccgaatctgggacacagataga
gagatgaaagtgcaggatatccccactggtgcagacagctgtgtgacaagcctctcctgt
gactctcaccgctcactcattgtggctggccttggcgacggttccattcgggtctatgat
aggagaatggcactcagtgaatgccgagttatgacctaccgtgagcatactgcctgggtg
gtgaaagcacacctccagaaacatcccgagggccacatcatgagcgtcagtgtcaatgga
gatgtacgtttcttcgacccccggatgcctgaatctgtgaatgtcctccaaatagtgaaa
ggattaacggcccttgacattcacccacaggcaaatttgtttgcatgtggctcaatgaat
caattcactgctatctacaatgggaatggagagctgatcaacaacatcaaatactatgat
gggtttatgggacaaagagttggagccatcagctgtttagctttccacccgcactggcct
catttggcagttggaagcaatgactactacatttcggtgtactccgtggagaagcgcatc
agataa

DBGET integrated database retrieval system