KEGG   Sarcophilus harrisii (Tasmanian devil): 100931028Help
Entry
100931028         CDS       T02286                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100931028
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100931028
Transcription machinery [BR:shr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100931028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 229 aa AA seqDB search
NKTLNFFVFCHLLSCSSYSGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHV
SGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSA
KLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLE
SGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
aataaaactttaaatttctttgtgttttgtcatcttctctcgtgttcctcttatagtggt
gtttctacaacgatagatcctttctgggacatcagtttagacttgcctggatcttcaact
ccattctggccacttagtccagggagcgatggcagcgtggtaaatggggaaagccatgta
tccggaaccaccacactcacagactgcttgcgaaggtttacaaggccagagcacttagga
agcagtgccaaaatcaaatgtagtggttgccatagctaccaggaatctaccaaacaactc
actatgaagaaattacccattgtggcctgttttcatctcaaacggtttgaacactcagcc
aaactgaggcgaaagatcactacatatgtctccttccctttggagctggacatgacacca
tttatggcttccagtaaagagagcagaatgaatggacagtatcaacagccaacggatagt
ctaaacaatgataataagtattccttgtttgcagtagttaatcaccaaggaaccttggag
agcgggcactataccagcttcattcggcaacacaaggaccagtggttcaaatgtgatgat
gccatcatcactaaggctagcattaaggatgttctagacagtgaagggtacttactgttc
tatcacaaacagttcctggagtatgagtag

DBGET integrated database retrieval system