KEGG   Sarcophilus harrisii (Tasmanian devil): 100931028Help
Entry
100931028         CDS       T02286                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 229 aa AA seqDB search
NKTLNFFVFCHLLSCSSYSGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHV
SGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSA
KLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLE
SGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
aataaaactttaaatttctttgtgttttgtcatcttctctcgtgttcctcttatagtggt
gtttctacaacgatagatcctttctgggacatcagtttagacttgcctggatcttcaact
ccattctggccacttagtccagggagcgatggcagcgtggtaaatggggaaagccatgta
tccggaaccaccacactcacagactgcttgcgaaggtttacaaggccagagcacttagga
agcagtgccaaaatcaaatgtagtggttgccatagctaccaggaatctaccaaacaactc
actatgaagaaattacccattgtggcctgttttcatctcaaacggtttgaacactcagcc
aaactgaggcgaaagatcactacatatgtctccttccctttggagctggacatgacacca
tttatggcttccagtaaagagagcagaatgaatggacagtatcaacagccaacggatagt
ctaaacaatgataataagtattccttgtttgcagtagttaatcaccaaggaaccttggag
agcgggcactataccagcttcattcggcaacacaaggaccagtggttcaaatgtgatgat
gccatcatcactaaggctagcattaaggatgttctagacagtgaagggtacttactgttc
tatcacaaacagttcctggagtatgagtag

DBGET integrated database retrieval system