KEGG   Sarcophilus harrisii (Tasmanian devil): 100931031Help
Entry
100931031         CDS       T02286                                 

Gene name
BAP1
Definition
(RefSeq) BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100931031 (BAP1)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100931031 (BAP1)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100931031 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 736 aa AA seqDB search
MTPFLLFLCYLLPFPILSNSGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKW
IEERRSRRKVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTL
SRMKDFTTGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVS
YVPIKGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMA
VVPDRRIKYESKLHVLKMNRQTVLEALQQLIRVTQPELIQTQKSQESQPPEDSKPASCKP
SLVLETSKTPLASEGSQTEGTEEVAGPCQPAPTHSPPSKPKLIVKPPVNSLNGVPANPSP
IVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYDEEEEEDVRNT
NSAIRYKRKGQVKQEPLPPSSDGQLCVLQPNTINVLAEKLKESQKDLSIPLSIKTSGGAG
SPAVAVPSHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLF
GEDDGLLRVDCMRYNRAVRDLGPIISTGLLHLSEDGMLCPLTITEGGKGSSPPARQSQTT
QIGVALEEKEMPEPSDREKAGLSRPPEQMCGEKYSPKELLALLKCVEAEIANYEACLKEE
VEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQR
KPDRRKRSRPYKAKRQ
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacgccttttcttctctttctctgctatctccttccttttccaatcctttccaactca
ggcctttttaccctgttggtagaagattttggtgttaaaggtgtacaagttgaggagatc
tatgatcttcagagcaaatgccagggtccagtgtatggcttcatcttcctcttcaaatgg
atcgaagaacgtcggtctcgtcgcaaggtctccaccctagtggacgagacttctgtgatc
gatgatgacatagtgaataacatgttcttcgcccatcagctgattcccaactcctgtgcc
actcatgccttactgagtgtccttctgaactgtagcaatgtggacctgggcccaacgctg
agccgtatgaaggatttcaccacgggcttcagcccagagagcaagggatatgccattggg
aatgctccagagttggccaaagcacataatagccatgccaggcctgagccacgacatctg
ccagagaagcagaatgggatcagtgctgtgcggacgatggaagcattccattttgtcagc
tatgtccccattaagggacgtctctttgagctagatgggctgaaagtgtaccccatcgat
catgggccctggggggaagatgaagagtggacagataaagcccgacgagtcatcatggaa
cggattggcctggctacagcaggggagccatatcatgacatccgatttaacctgatggcg
gtagtgcccgaccgcaggatcaagtacgaatctaagctgcacgtcctgaagatgaaccga
cagacggtgttggaagccttgcagcagctgatccgagtgactcagccagaactgattcaa
acccagaagtcccaagagtctcagccccctgaggactccaagccggcctcctgcaagccc
tctctggtgcttgaaacaagcaagaccccactggcctctgagggttctcaaacagaggga
actgaagaggtagcgggaccttgccagccagcccccacacatagcccacccagcaaaccc
aagctcatagtgaagcctccagtcaacagtctcaacggagtcccagcaaatcccagtccc
attgttcagcggctcccagctttcctggataaccataactatgccaagtctcccatgcaa
gaagaagaggacctggcagcaggtgtgggccgcagccgggtcccagttcgtccaccacaa
cagtactcagatgatgaggatgattatgatgaggaagaggaagaggatgttcggaacaca
aattctgccatcaggtacaagcggaaagggcaggtcaagcaggagcccttgcctccctcc
tccgatgggcagctctgtgtcctgcagcccaacaccatcaacgtactggctgagaagctt
aaagagtcccagaaagacctctcaattcctctgtccatcaagactagtgggggggccggg
agcccagcggtagccgtgccctctcactctcagccttcgcccacccccagcaacgagagc
accgacacagcatctgaaatagggagtgccttcaactccccactccgctcccctatccgt
tctgccaaccccacccgcccctccagccccgtcacctcccacatctccaaggtgcttttt
ggggaggacgatgggttgttgcgagtggactgtatgcgctacaaccgggctgtacgcgac
ttggggcccatcatcagcacaggccttctgcatctctcagaggatgggatgctgtgtcct
ctcaccatcacagaaggtgggaaaggctcctcgccgcctgccagacagagccagaccacc
cagatcggcgtcgccctggaggagaaggagatgcctgaaccgagtgacagagagaaagcc
gggctgagccggcccccggagcagatgtgtggggagaagtattcccccaaagagctgctg
gcactgctgaagtgtgtggaagcagagattgcaaactatgaagcctgtctcaaggaagag
gtggagaagaggaaaaaatttaagattgatgaccagagaagaacccacaactacgatgag
ttcatctgcacatttatttccatgctggctcaggaaggcatgctggccaacctcgtggag
cagaacatctccgtgcggcgacgacagggcgtcagcattggccggctccacaaacagagg
aagcctgacagacggaaacgctcccgtccttacaaagccaagcggcagtga

DBGET integrated database retrieval system