KEGG   Sarcophilus harrisii (Tasmanian devil): 100931147Help
Entry
100931147         CDS       T02286                                 

Gene name
EHMT2
Definition
euchromatic histone-lysine N-methyltransferase 2
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:shr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1303 aa AA seqDB search
MVKAREACSKWSPRHPRQSLLREPAHHSGILTRENGSRIGHGSFKGSLSPPSFHYSPIPP
DPRDPSGRAPPGPPARAARAAAAGAAAAAAAAAEGEAPGEMGGALLLEKEPRGTAERGLS
SSGDKCPGEETPSQDHPESVEPTGPSSPASVTVTVGDEGADTPVGSTPLIGDEPESPEGD
EGIHNNRILLGHATKSFPSSPSKGGSACPSRAKITMTGAGKSPPSVQSLAMRLLSMPGAQ
GAGAGPEPVPTSTPIPTSPEGKPKVHRARKTMSKPGNGQPPVPEKRPPEVQHFRMSDDLH
SMGDMGTDIAKRRKMDLGSGGPHKRGPHGLLEELDPAGGTEDMTLEKENQEAMEDWDTDV
GEGFSLYYDSYSVDERIDSDSKSEAEVLAEQLSEEEEEEEEEEEEEEEEEEEEEEDDEES
GNQSDRSGSSGRRKAKKKWRKDSPWVKPNRKRRKRETPRTKEQRGVNGVGPSGPSEYIEV
PLGSLELPSEGNLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCM
ATESMDGELSGCSAGIQKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGYFCTAGTFL
ECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIAWSDGVAPPPGTAAPVPPP
PAQDAPGRADTSQPSARMRGHGEPRRPLCDPLADTIDSSGPSLALPNGNILSAVGLGAGP
GREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVVLMLLDNLDPNFQSDQQSKRT
PLHAAAQKGSVEICHVLLQAGANINAVDKLQRTPLMEAVANNHVEAARYMVQRGGCVYSK
EEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDNGGWTPIIWAAEHKHIEVIRMLLTR
GADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCV
LLFLSRGADPELRNKEGDTAWDLTPERSDVWVALQLNRKLRLGVGNRVLRTEKIICRDVA
RGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLC
GQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACACWRNCKNRVVQSGIKVRLQLYRTAK
MGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNI
SRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFT
CQCGSEKCKHSAEAIALEQSRLARLDPHPELIADLGSLPSLSS
NT seq 3912 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccagggaagcctgctcgaagtggtctccgaggcatcctcgccaatccctg
ctccgggagcctgcgcaccactctgggatcctaacccgggaaaatggcagtagaataggc
catggctcctttaagggttctctttctcctccctccttccactactcccccatccccccc
gacccacgtgacccgagcggccgcgcgcctcctgggccccccgcgcgagcggctagggcg
gcggcggcgggagctgcagcagcagcggcggcggccgccgagggggaggcccctggtgag
atggggggggcgctgctgctggagaaagaaccccggggaactgcagagagaggtcttagc
tcctcaggagataagtgtcctggagaggagaccccgtcccaggatcatccagagtctgtg
gaacccactggtccctcatctcctgcctcagtcacagtgactgtaggagatgagggggct
gacactccagtggggtccacacccctcattggtgatgaaccagagagtccagagggagat
gagggaatccacaataataggatattattaggccatgccactaagtcctttccctcatcc
cccagcaaagggggcagcgcctgtccaagccgggcaaagattaccatgacaggagctggg
aaatcacctccctcagtccagagtttagccatgcggcttttaagcatgcctggggcacaa
ggggctggagctgggcctgagcctgtacctacctccacccctatccccaccagccctgaa
gggaagcccaaggtccaccgagctcgaaaaaccatgtccaaaccagggaatggacagcct
ccagtccctgagaaacgcccccctgaagttcagcattttcgaatgagtgatgatcttcac
tcaatgggggatatgggaacagacattgccaaaaggaggaaaatggacttgggaagtgga
ggcccccacaagagaggaccccatggtttgttggaagagctggaccctgctgggggaact
gaggatatgaccctagagaaggaaaaccaagaggccatggaggactgggatacagatgta
ggagaaggcttcagtttatactatgattcatattctgtggatgagcgaattgactcagac
agtaagtctgaggcagaggtcttagcagagcaattgagtgaagaagaggaagaagaagaa
gaagaagaagaggaggaggaggaagaggaggaagaagaggaagaagatgatgaggagtct
ggcaatcagtctgatcgaagtggctctagtggtcgaagaaaagccaaaaagaagtggcgg
aaagacagtccttgggtaaaacctaacagaaaacgtcgaaagcgggaaacaccacgtacc
aaggaacaacggggggtgaatggtgttggtccctctggccccagtgagtatatagaagtg
cctctagggtctctggagctacccagcgagggaaacctttctcccaatcatgctggggtg
tcaaatgacacatcatccctggaaacagagcgggggtttgaggagttacccctgtgcagc
tgccgcatggaagctccaaaaattgatcggatcagcgaaagggctggtcacaaatgcatg
gccacagagagcatggatggagagctgtcgggctgcagtgcaggaattcaaaagcgggaa
acaatgaggccttcaagcagagtagctctgatggtcctttgtgagacacatcgagcccgg
atggtcaagcatcactgctgcccaggctgtggctatttttgcacagcgggcacattcttg
gagtgtcaccctgatttccgagtggcccatcgcttccacaaagcctgcgtgtcccagctg
aatgggatggttttctgcccccactgtggggaagacgcttctgaggcccaggaggtgaca
attgcctggagtgatggggtggccccacctcctggcactgctgctcctgtccccccaccc
cctgcccaggatgcccctggacgggccgacacttcccagcccagtgctaggatgcggggt
catggagaaccaaggcgccctctctgcgacccactggctgataccatcgacagctcaggc
ccttccctggcattgcccaatggcaatatcctctcagctgtaggtctaggagctgggcca
ggccgagaagccctggaaaaggcactggtcatccaggaatctgagcgaaggaagaaactt
cgcttccatccgcgtcaattgtacctgtctgtaaagcagggggaattgcagaaggtcgtt
ctgatgctcttggacaacctggaccccaacttccaaagtgaccaacagagcaagcgtaca
cccctgcatgcagctgcacaaaaaggctctgttgagatctgccatgtgttgctccaggct
ggagcaaatatcaatgctgtggataagctgcagcggacccctctgatggaggctgtggcc
aacaaccatgtagaggccgcccgatacatggtgcagcgaggaggttgtgtttatagcaag
gaggaagatggctctacttgtcttcatcatgcagctaagattggcaacctggagatggtc
agcctgctgctcagtactggccaagtggatgtaaatgctcaggataacgggggctggaca
cccatcatttgggcagctgaacataaacacattgaagtcattcgaatgctgctgacccga
ggagcagatgtcacccttactgacaatgaagagaatatttgtttgcactgggcgtccttc
acaggcagtgctgccattgccgaggtcctgctgaatgcccgttgtgacctccatgccgtc
aactatcatggagacacacccttgcatattgctgctcgagagagctaccacgactgtgtg
ctgcttttcttgtccagaggtgctgatccagagttacggaacaaagaaggagatacagca
tgggacctgacccctgaacgctcagatgtctgggtggccctgcagctaaaccgaaagctt
cgccttggtgtgggtaaccgagtattgcgaacagaaaagatcatttgcagagatgtagct
cggggttatgagaatgtgccaatcccctgtgtcaatggagtggatggggaaccttgtcca
gaagattacaaatacatctctgagaactgcgaaacatcaactatgaatattgaccgaaac
atcacacatttgcagcactgcacctgcgtggatgactgctcaagctccaactgtctctgt
ggccaactgagtataaggtgctggtatgacaaggatggacgtcttcttcaggaatttaat
aagattgagcccccactgatctttgaatgtaaccaggcttgtgcttgctggagaaactgc
aagaatcgagtagtacagagtggtatcaaggttcggctacagctttatcgtactgccaag
atgggctggggtgtccgtgcgttacagaccattccccagggaaccttcatctgcgagtat
gttggggaactgatctcagatgctgaggcagatgtccgggaagatgactcttacctcttt
gacctggacaataaagatggagaggtgtactgcattgatgctcggtattatggcaacatc
agccgttttatcaatcatttgtgtgaccctaacatcatccctgttcgagtcttcatgctt
caccaagacctcaggttcccccgaatcgccttcttcagttctcgagacatccggacgggc
gaggaactagggtttgactatggtgaccggttctgggacattaaaagcaagtatttcacc
tgtcaatgtggctctgaaaaatgcaagcactcagctgaagccatcgccttggagcagagc
cgcctggcccgcctggacccccacccagaactgattgctgaccttgggtccttaccctcc
ctcagttcctga

DBGET integrated database retrieval system