KEGG   Sarcophilus harrisii (Tasmanian devil): 100931155Help
Entry
100931155         CDS       T02286                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100931155 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100931155 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100931155 (TYMP)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100931155 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 431 aa AA seqDB search
MSATSRERNGRAAPSAFPPGRTQEWQRQTRQGQLIRKKRDGDRLEDAEIRSFIQGVTQGT
VQEAQIGAMLMAIRLRGMDLGETEILTRALAESGQQLQWPEAWRRLLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFSVVQSPEQMRELLEHAGCCIV
GQSQELVPADKILYAIRDVTATVDSLPLITASILSKKAVEQLSTLVMDVKFGEAAIFPSQ
EKARELAHALVGVGARLGVRVAAALTTMDSPLGRCVGHSLEVEEALQCLEGGGPPDLRDL
VTQLGGSLLWLNGQAPTLTQGKAQMGATLDNGSALGQFRAMLEAQGVAPKLAQALCSGSP
AQRQGLLPTAPTKDELRTASEGTVEKIQALPLAQVLHELGAGRNRAGEPLHHDVGLELLV
SLGQRVSAGES
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccacatccagagagagaaacggcagggctgcaccttccgctttccctcctggc
agaacccaagaatggcagcgacagacccgacagggccagctgattaggaagaagcgagat
ggggatcgcctggaggatgctgagattcggagctttattcagggggtgacacaggggaca
gtgcaggaggcgcaaataggtgccatgctcatggctatccgcttgcgaggcatggacctg
ggcgagacggagattctgacccgagccctggctgagtctgggcagcagcttcagtggccc
gaggcctggagacggctgctggtggacaagcattcgacggggggagtgggggacaaagtc
agcctggtcctggcgcctgctctggccgcctgcggctgcaaggtgccgatgatcagcggc
cggggactgggacacactgggggcacgctggacaagttggaatccatcccaggcttctcg
gtggtacaaagtccagagcagatgcgggagctgctggagcatgcaggctgctgcattgtg
gggcagagtcaggagctggtccctgcagacaaaatcctctatgccatccgggatgtgact
gccacagtggacagcctccccctcatcacagcctccatcctcagtaagaaggctgtggaa
caactctcgaccctggtgatggatgtgaaatttggagaagcagccatcttcccaagccaa
gaaaaagctcgggagctggcccacgccctggtgggcgtgggggcccgcctgggggtccgg
gtggcggccgcgctgacgacgatggacagccctctgggccgctgtgtgggccacagcctt
gaagtggaggaggccttgcagtgtctggagggaggaggtcccccggacttgcgggacctt
gtcacccaactaggaggatccctgctatggctgaatggccaagctccaaccttgacccag
gggaaggcccaaatgggggccacgctggacaacggctctgcgctgggccagttccgggcc
atgctggaggcccagggtgtggcccccaagctggcccaagctctgtgctcgggatctcct
gcccagcgccaaggcctgctccccacagcccccaccaaggacgagctgagaacagcttca
gaggggacagtggagaagatccaggccctgcccctggcccaggtcctccacgagctgggg
gctggccggaaccgcgcgggagagcccctccaccacgatgtggggctggagctgctggtg
agcctcggacagcgggtcagcgcaggtgagagctga

DBGET integrated database retrieval system