KEGG   Sarcophilus harrisii (Tasmanian devil): 100931155Help
Entry
100931155         CDS       T02286                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:shr00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:shr00983]
Human Diseases; Cancers; Bladder cancer [PATH:shr05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 621 aa AA seqDB search
MVSLILSRCIFRLLSTFLLEAKLALSVCCPVSRRPAGGVADLAAAARQSKATGREDWCAL
PELVSGGLPQHLLALRCRKLLQESGMDKSVWVGTWRPHRPRGPIAALHSGPGPKYMLPPS
TDGRAAPSAFPPGRTQEWQRQTRQGQLIRKKRDGDRLEDAEIRSFIQGVTQGTVQEAQIG
AMLMAIRLRGMDLGETEILTRALAESGQQLQWPEAWRRLLVDKHSTGGVGDKVSLVLAPA
LAACGCKVPMISGRGLGHTGGTLDKLESIPGFSVVQSPEQMRELLEHAGCCIVGQSQELV
PADKILYAIRDVTATVDSLPLITASILSKKAVEQLSTLVMDVKFGEAAIFPSQEKARELA
HALVGVGARLGVRVAAALTTMDSPLGRCVGHSLEVEEALQCLEGGGPPDLRDLVTQLGGS
LLWLNGQAPTLTQGKAQMGATLDNGSALGQFRAMLEAQGVAPKLAQALCSGSPAQRQGLL
PTAPTKDELRTASEGTVEKIQALPLAQVLHELGAGRNRAGEPLHHDVGLELLVSLGQRFH
PRLLGLTGTPEQVSPGGRNFRVYYSAGPPDEDQDYIVDHSIIIYLLNPDGLFTDYYNRSK
TEEQITDSVRRHMAAFQSVLG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtttgattctgagccgctgcatcttcaggctcctctccacctttctgctggag
gcgaaactggctctttctgtttgttgtccggtttctcggagaccggccggaggcgtggcc
gatctggcggccgcagcccggcagtcgaaggccaccggccgggaagattggtgcgccctc
ccagagctggtctctggggggcttccccagcacctcctggctctcaggtgccgcaaactt
cttcaagagtccgggatggacaaaagtgtgtgggtgggcacttggcggccccaccgcccc
cggggccccattgcagcacttcactctggtcctggacccaagtacatgctgccccctagc
accgacggcagggctgcaccttccgctttccctcctggcagaacccaagaatggcagcga
cagacccgacagggccagctgattaggaagaagcgagatggggatcgcctggaggatgct
gagattcggagctttattcagggggtgacacaggggacagtgcaggaggcgcaaataggt
gccatgctcatggctatccgcttgcgaggcatggacctgggcgagacggagattctgacc
cgagccctggctgagtctgggcagcagcttcagtggcccgaggcctggagacggctgctg
gtggacaagcattcgacggggggagtgggggacaaagtcagcctggtcctggcgcctgct
ctggccgcctgcggctgcaaggtgccgatgatcagcggccggggactgggacacactggg
ggcacgctggacaagttggaatccatcccaggcttctcggtggtacaaagtccagagcag
atgcgggagctgctggagcatgcaggctgctgcattgtggggcagagtcaggagctggtc
cctgcagacaaaatcctctatgccatccgggatgtgactgccacagtggacagcctcccc
ctcatcacagcctccatcctcagtaagaaggctgtggaacaactctcgaccctggtgatg
gatgtgaaatttggagaagcagccatcttcccaagccaagaaaaagctcgggagctggcc
cacgccctggtgggcgtgggggcccgcctgggggtccgggtggcggccgcgctgacgacg
atggacagccctctgggccgctgtgtgggccacagccttgaagtggaggaggccttgcag
tgtctggagggaggaggtcccccggacttgcgggaccttgtcacccaactaggaggatcc
ctgctatggctgaatggccaagctccaaccttgacccaggggaaggcccaaatgggggcc
acgctggacaacggctctgcgctgggccagttccgggccatgctggaggcccagggtgtg
gcccccaagctggcccaagctctgtgctcgggatctcctgcccagcgccaaggcctgctc
cccacagcccccaccaaggacgagctgagaacagcttcagaggggacagtggagaagatc
caggccctgcccctggcccaggtcctccacgagctgggggctggccggaaccgcgcggga
gagcccctccaccacgatgtggggctggagctgctggtgagcctcggacagcggttccac
ccgcggctgctggggctgacgggcaccccggagcaggtgagcccgggcgggcgcaacttc
cgggtctactacagcgcggggcctccggacgaggatcaggactacatagtggaccactcc
atcatcatctacctgctcaatcccgacggccttttcaccgactactacaaccggagcaag
acggaggagcagatcacggacagcgtgcggcgccacatggccgccttccaaagtgtcctg
ggctga

DBGET integrated database retrieval system