KEGG   Sarcophilus harrisii (Tasmanian devil): 100931209Help
Entry
100931209         CDS       T02286                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100931209 (USP19)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100931209 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1379 aa AA seqDB search
MSGGASATGQRRCPQGLEDATNKKKQKDRVNQESKDGEPKRVPVPGLETYTLREEQEFKE
AELLLDWKQNADEVIVKLHVGSGPLRIEEIDAAFTDTDCVVQLPDGRQWSCIFYEEIESS
CSKVQARKGGVLQLLLHKKIPLRTWPSLLKKKPISQDLGAGAHCKENGQELPPSLLEPGS
SPEPQRGKQEPRNQKRAQGRGEAGIGTGPGAQAGPSAKRAVHLRGVTEGEASRGSPGPRG
DGSPSSPESTVQPVSTEPEAIVGPQQLSLMTQHTQQSIQEENQGLCLESTLEGEKMIPHQ
NEMACPALPQGKEGDQNKEEAATTTLENSAEEPEPMVNLTFVKNDSYEKGPDSVVVHVYV
KEICRKISRVLFREQDFTLVFQTSDMNFLRLHPDCGPHTTFRWQVKLRNMIQPEQCVYHF
TSSRIDICLRKRQSQRWGGLEAPATRVGGAKVAMPTGPTPLDAAPPGGSPLASQEEARVG
EKEKVKARTEESGLDSVAARTPPEHVALKPEPPLTSPKPTCMVPPMPHSPMSSESVEEEE
EEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDYFHDRSFEAEINYSNPLGTGGR
LAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLN
RIQNKPYTETVDSDGRPDEVVAQEAWQRHKMRNDSFIVDLFHGQYKSKLVCPVCSKVSIT
FDPFLYLPVPLPQKQKVLTVYYFAKEPHKKPVKFLVSISKENSSAMEVLDSLAQSVHVKP
ESLRLAEVIKNRFHRVFLPSHSLDTVSPTDLLLCFEVLSPELAKERVVVLQVQQRPQVPS
VPIAKCAACQKKQQSEDEKLKRCTRCYRVGYCNQVCQKTHWPDHKGLCRPENIGFPFFIS
VPESRLTYARLAQLLEGYARYSVSVFQPPFQLGRVSPEQSPQVLSSSTSPVLSTLEAGGG
DRDLRPSPESQVSPTVAELGDTGASRSRAAPDRGSVPSLDTGLSESTVSMANEGGFSKES
AGERLLRPEAAVPGYQHPAEVLSAHPPPFFINKIDATNKEQKLEDKGEAPLDLSDDCSLA
LVWKNNERLKEFVLVGSKELECVEDPSSASEAARAGHFTLEQCLNLFTKPEVLAPEEAWY
CPKCKQHREASKQLMLWRLPNVLIIQLKRFSFRSFIWRDKINDMVEFPLRNLDLSKFCIG
QKDDRQLPTYDLYAVINHYGGMIGGHYTAYARLPSDKNSQRSDVGWRLFDDSTVTTVDES
QVVTRYAYVLFYRRRNSPVERPPRAPATDHHPDLGPATEAATSQASRIWQELEAEEELGP
EASGRLGHWGPRGWAAPPRRAPDAPDEGCLRYFVLGTMAALVALVLNVFYPLVSQSRWR
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaggggctagtgcaacaggccagagaagatgcccccaggggctggaggatgcc
accaacaagaagaaacagaaggatcgtgtgaaccaggagagcaaagatggggagcccaaa
agagtgcctgttcctggtttggaaacatatacccttagagaggagcaggaattcaaggaa
gctgaactgctactagattggaagcaaaatgcagatgaagtgattgtaaagctgcatgtg
gggtctgggcccttgcggatagaagagatagatgcagccttcacggatacagactgtgtg
gtacagttaccagatggccggcagtggagttgcatcttctatgaggagattgaaagttct
tgcagcaaggtccaggctcgaaagggtggtgtcctacagttattattgcataagaagatt
ccacttcggacctggccctccctcctgaaaaagaagcccataagccaggatttgggagct
ggagcccattgcaaagaaaatggacaagagctgccccccagtcttctggaacccgggtct
agtccagagccccaaagagggaagcaagagccacgaaatcagaagcgagctcagggccga
ggtgaagcaggcataggaacaggccctggagctcaagcaggacccagtgctaaacgggca
gtacacctccggggggttactgaaggggaggcttccaggggcagcccaggtccccgaggc
gatggctctccttcttcaccagaatccacagttcagcctgtttcaacagaacctgaggca
attgttgggccacagcagctatccttgatgacccaacatactcaacagtccattcaagag
gaaaaccaaggcctttgtttagaaagtactctagaaggggagaagatgataccccaccag
aatgagatggcctgtccagccctcccccagggtaaagaaggggaccagaacaaggaggaa
gcagcaacaacaactttggaaaattcagctgaggaacccgagcccatggtgaacctgaca
tttgtgaagaatgactcatatgagaaaggtccagattcagtggttgtacatgtatatgtg
aaggaaatctgccgcaagatttctcgtgtactgtttcgtgaacaggacttcaccctagtg
tttcagaccagtgatatgaactttctgcggctgcacccagattgtggaccacatacaacc
ttccgatggcaggtgaagctcaggaacatgattcagccagagcagtgtgtgtatcacttc
acttcttcacgcatcgatatatgcctcagaaagcggcagagtcagcgctgggggggcctt
gaggccccagccacacgagtgggtggtgcaaaggttgccatgccgacaggcccaacccct
ctggatgcagctccaccaggtggttcccctctagctagccaggaggaggctcgagttggg
gagaaggagaaagtgaaggcccggactgaagaatcagggctggacagtgtggctgcccgc
actccaccagagcacgtggctctgaagccggagcccccccttacctcacctaagcccact
tgcatggtcccccccatgcctcatagccccatgagcagtgagagtgtggaagaggaggag
gaagaagagaagaaggtgtgcttgcctggtttcacaggccttgtcaacctgggcaacact
tgcttcatgaacagtgtcattcagtccctgtccaacacccgagagcttcgggactacttc
catgatcgctcttttgaggcggagataaactacagcaatcctctgggcacagggggacga
ctggccatcggctttgcagtgctgctgcgagcgctgtggaagggcacccaccatgccttt
cagccctctaagctgaaggccattgtggcgagcaaggccagccagttcactggctatgct
cagcatgatgctcaggagttcatggccttcctgttggatgggttacatgaggacctgaac
cgaatccagaataagccctatacagagactgtagactctgatgggcgtcctgatgaggtg
gttgctcaggaggcatggcaacggcacaaaatgaggaacgactctttcattgtggatttg
ttccatggacagtacaagtcaaagttggtgtgccctgtgtgttccaaggtttccatcact
ttcgacccgttcctgtacctgcctgtccccctgcctcaaaagcagaaagtactcactgtg
tactactttgccaaggagccacacaagaagcctgtgaagttcctggttagcatcagcaaa
gaaaactccagtgcaatggaggtgcttgactccctggcacaaagtgttcatgtgaaacct
gagagccttcggctggctgaggtgattaagaaccgatttcaccgtgtgttcctgccatca
cactcactggacaccgtctctcccactgatctgctcctttgctttgaagtgctatcccca
gagctagccaaggagcgggtggtagtccttcaagtgcaacagcgtcctcaggtgcccagt
gtccccattgccaagtgtgctgcttgccagaagaagcagcagtctgaggatgagaaattg
aagcgttgtacccgctgttaccgtgttggctactgcaaccaggtttgtcagaagactcac
tggccagatcacaaaggcctgtgccgtccagagaatattggttttcccttcttcatcagt
gtccctgagtcccgcctcacctatgctcgccttgctcagctgctggaaggctatgctcgg
tactcagtgagcgtgttccagccacccttccagttaggccgtgtatctccagaacagagc
ccccaagtgctaagcagttctacatctcctgtgctgagcactttggaggctgggggtggg
gaccgggacttaagaccctcaccagaatcccaagtatccccaacagtggctgagcttggt
gacacaggtgcctcaaggagccgggcagcccctgatcggggttctgtgcccagtcttgac
acaggcctctcagagtcaacagtcagcatggccaacgaggggggattttctaaggaatct
gctggggagaggttactcaggcctgaagctgctgtcccaggataccagcacccagctgaa
gtcctaagtgcccatccacccccattttttatcaacaaaattgatgccaccaataaggag
caaaagctggaagacaaaggtgaagcccccctggacctgagtgatgactgcagcctggcc
ttggtgtggaagaacaatgaacggctgaaggagtttgtgctagttggctccaaggagctc
gagtgtgtggaagaccccagctcggccagtgaggcagccagggctggccattttactcta
gagcagtgtctcaatctcttcaccaagcctgaggtgctagccccagaagaagcctggtac
tgtccaaagtgtaagcagcacagagaagcctccaagcagctgatgctgtggcgccttcca
aatgtgctcattatccagctgaagcgcttctcctttcgaagcttcatctggagggataaa
attaatgacatggtggaattccctctcaggaacctggacttgagcaagttttgcataggc
cagaaggatgaccggcaacttccaacctatgacctatacgcagtcatcaaccactatggg
ggcatgattggaggccactacactgcatatgcccgcctgcccagtgacaagaacagccag
cggagtgatgtgggctggagactatttgatgacagcacagtgaccacagtcgatgaaagc
caagtagtgacccgctatgcctatgtcctcttctatcgtcggcgaaactctcctgtggag
aggcctcccagggctcctgctaccgaccaccacccagatctgggcccggccacagaggcg
gccaccagccaggcttcccggatctggcaggagctggaagcagaggaagaactggggcca
gaggcctcaggacgcctaggccactgggggccccgaggctgggcagccccaccgaggcgg
gccccagacgcaccagatgagggctgcctccgctacttcgtcctgggcaccatggctgcc
ctggtggcactcgtcctcaatgtgttctatccactggtgtcccagagccgatggagatga

DBGET integrated database retrieval system