KEGG   Sarcophilus harrisii (Tasmanian devil): 100931441Help
Entry
100931441         CDS       T02286                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00020  Citrate cycle (TCA cycle)
shr00310  Lysine degradation
shr01100  Metabolic pathways
shr01200  Carbon metabolism
Module
shr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100931441 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100931441 (DLST)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100931441 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 100931441
NCBI-ProteinID: XP_023357836
Position
1
AA seq 455 aa AA seqDB search
MLSRSRCLSRAFSRSLFAFQKGNCPLGRRSLPGISLCQGPAYLYSKKIVLDDSVLNVRFF
RTTAVCKNDVITVKTPAFAESVTEGDVRWEKAVGDTVSEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGAAPPKAKPAEAPPAAAPKPESVAAPPPPQPVAS
IPTQMPPVPPVSSQPVDTKPVSAVKPSDAVSAAEPGAGKGVRSEHRVKMNRMRQRIAQRL
KEAQNTCAMLTTFNEIDMSNIQEMRARHKESFLKKHNLKLGFMSAFVKASAFALQEQPAV
NAVIDDTTKEIVYRDYIDISVAVATPRGLVVPVIRNVETMNFADIERTINELGEKARKNE
LAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAIGGKVEVRPMMYV
ALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgttcacgttgcttgtcccgggcgttcagccgttcgcttttcgccttccag
aaggggaactgccctttagggaggcgttccttgcctggtatctccctatgccagggaccg
gcttacctttacagtaaaaagattgttttagatgactctgtcttgaatgttcgcttcttc
agaactacagcagtgtgcaagaatgatgttattacagtcaagacaccagcatttgcagag
tctgtcacagagggtgatgtcaggtgggagaaagcggttggagacacagtttcagaagat
gaagtggtttgtgaaattgaaaccgacaagacatctgtgcaggttccatcaccggcaaat
ggagtgattgaagccctgttggtacctgacggagggaaagtggaaggaggaacccctctg
ttcactctcaggaaaactggcgctgctcctcctaaagccaaaccagctgaagctccccct
gctgcagcccctaaaccagaatctgtggcagctcctccccctccccaacctgttgcatct
atacctactcagatgcccccagttcctcctgtgtcatcacaacctgttgataccaaacct
gtgtctgcagtaaaaccctctgatgctgtatcagcagcagagccaggagctggcaaaggt
gtgcgctcagaacatagggtgaaaatgaacaggatgcgacaacgtattgctcagcgccta
aaggaggcccaaaatacatgtgcaatgctgaccactttcaacgagattgatatgagtaat
atacaggagatgcgggcccgacacaaagagagttttctgaaaaaacacaacctgaaacta
ggcttcatgtcagcatttgtgaaggcctctgcctttgccttacaggaacagccagcagtg
aatgcagtgattgatgacacaaccaaagagattgtgtatagggattatatcgacatcagt
gttgctgtggccactccacgggggcttgtggtaccagttattaggaatgtggaaactatg
aattttgcagacatcgaacgaaccataaatgagctgggagagaaggcccgaaagaatgag
cttgccattgaagatatggatggtggcactttcacaatcagtaatggaggagtctttggc
tctctctttgggactcccatcatcaacccccctcagtcagccatcctgggcatgcatgcc
atttttgataggcctgttgctattggaggcaaggtggaagtgcggcccatgatgtatgta
gcactgacttatgaccaccgactgattgatggcagagaggcagtgactttccttcgaaaa
atcaaggcagcagtggaggatcctcgtgtcctgctacttgacctttag

DBGET integrated database retrieval system