KEGG   Sarcophilus harrisii (Tasmanian devil): 100931441Help
Entry
100931441         CDS       T02286                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100931441 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100931441 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100931441 (DLST)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100931441 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 564 aa AA seqDB search
MSTNICGKINLINHCPLFCSSLRKVFSDVAKMNWDASVSGSQGVGYVTCPELECVKGLRS
DLNLGSPNLRASTVSTVPPCCPKVVDRMLCEEEKGEEISWSSSGAERRLLFLLGFFTRIT
ASSPRLEGPKGNCPLGRRSLPGISLCQGPAYLYSKKIVLDDSVLNVRFFRTTAVCKNDVI
TVKTPAFAESVTEGDVRWEKAVGDTVSEDEVVCEIETDKTSVQVPSPANGVIEALLVPDG
GKVEGGTPLFTLRKTGAAPPKAKPAEAPPAAAPKPESVAAPPPPQPVASIPTQMPPVPPV
SSQPVDTKPVSAVKPSDAVSAAEPGAGKGVRSEHRVKMNRMRQRIAQRLKEAQNTCAMLT
TFNEIDMSNIQEMRARHKESFLKKHNLKLGFMSAFVKASAFALQEQPAVNAVIDDTTKEI
VYRDYIDISVAVATPRGLVVPVIRNVETMNFADIERTINELGEKARKNELAIEDMDGGTF
TISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAIGGKVEVRPMMYVALTYDHRLIDG
REAVTFLRKIKAAVEDPRVLLLDL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaacatttgtggaaaaataaacttgatcaatcactgtcctctcttctgctcc
tctctccgtaaagttttttccgatgtggctaagatgaattgggatgcttctgttagtggc
tcccagggtgtgggttatgtgacatgcccagagttagaatgtgtcaaaggtctgagatca
gatttgaacttaggttctcctaacttaagggccagtactgtatccactgtaccaccttgc
tgccccaaggtggtggacaggatgctctgtgaagaagaaaagggagaggagatcagctgg
tccagtagcggggcggagcgcaggctgctcttcctgctcgggttctttactaggattacc
gcctcctccccccggctggaggggccgaaggggaactgccctttagggaggcgttccttg
cctggtatctccctatgccagggaccggcttacctttacagtaaaaagattgttttagat
gactctgtcttgaatgttcgcttcttcagaactacagcagtgtgcaagaatgatgttatt
acagtcaagacaccagcatttgcagagtctgtcacagagggtgatgtcaggtgggagaaa
gcggttggagacacagtttcagaagatgaagtggtttgtgaaattgaaaccgacaagaca
tctgtgcaggttccatcaccggcaaatggagtgattgaagccctgttggtacctgacgga
gggaaagtggaaggaggaacccctctgttcactctcaggaaaactggcgctgctcctcct
aaagccaaaccagctgaagctccccctgctgcagcccctaaaccagaatctgtggcagct
cctccccctccccaacctgttgcatctatacctactcagatgcccccagttcctcctgtg
tcatcacaacctgttgataccaaacctgtgtctgcagtaaaaccctctgatgctgtatca
gcagcagagccaggagctggcaaaggtgtgcgctcagaacatagggtgaaaatgaacagg
atgcgacaacgtattgctcagcgcctaaaggaggcccaaaatacatgtgcaatgctgacc
actttcaacgagattgatatgagtaatatacaggagatgcgggcccgacacaaagagagt
tttctgaaaaaacacaacctgaaactaggcttcatgtcagcatttgtgaaggcctctgcc
tttgccttacaggaacagccagcagtgaatgcagtgattgatgacacaaccaaagagatt
gtgtatagggattatatcgacatcagtgttgctgtggccactccacgggggcttgtggta
ccagttattaggaatgtggaaactatgaattttgcagacatcgaacgaaccataaatgag
ctgggagagaaggcccgaaagaatgagcttgccattgaagatatggatggtggcactttc
acaatcagtaatggaggagtctttggctctctctttgggactcccatcatcaacccccct
cagtcagccatcctgggcatgcatgccatttttgataggcctgttgctattggaggcaag
gtggaagtgcggcccatgatgtatgtagcactgacttatgaccaccgactgattgatggc
agagaggcagtgactttccttcgaaaaatcaaggcagcagtggaggatcctcgtgtcctg
ctacttgacctttag

DBGET integrated database retrieval system