KEGG   Sarcophilus harrisii (Tasmanian devil): 100931469Help
Entry
100931469         CDS       T02286                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100931469
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931469
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100931469
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100931469
   05222 Small cell lung cancer
    100931469
  Infectious diseases
   05146 Amoebiasis
    100931469
   05145 Toxoplasmosis
    100931469
Cell adhesion molecules and their ligands [BR:shr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100931469
   VLA-6
      100931469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1563 aa AA seqDB search
MRLILGHQGWGLGGLELWLLLVLIALGVGSFLYDCFLSLVLAKAPAQNPDLPSAGCSRGS
CYPATGDLLVGRADRLTASSTCGLRGPEPYCIVSHLQDEKKCFLCDSRHPFSARHPQSHR
IQNVVTSFAPQRRSAWWQSENGVSTVTIQLDLEAEFHFTHLIMTFKVIYRVLDPAIPITD
PYSPRIQDLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHAS
QCARAPGAPAHAEGMXXXXXXXXVSGQCRCKEHVAGPRCQRCRDGYFGLSAADPQGCQRC
RGDPRGPVPGGPPCDAGSGACFCKRLVTGRHCERCLADHWGLSHDLLGCRPCDCDVGGAL
EPRCAEDSGQCRCRRHMFGRRCDQVQPGYFLPFLDHLTFEAEAARGQALDIIERMAHPGM
AASWTGVGFVRLREGQTLEFVVATVSQAMDYELLLRYEPQVPEQWAEVTLTVQRPGPISP
SSPCGTTVPEDDHFRGMLQPGTRYVLLPSPVCLEPGLSYTIRLELSRAGGDVRPGAPPPG
LLFDSVTCQCDPQGSLSSECQAHGGQCPCKPHVTGRRCHPCAPGTFGFGTSGCRACQCSP
EGSLSSLCHEASGQCPCRPGAFGPRCDRCQPGQWGFPSCRPCHCNGHADDCDPRTGSCQS
CRDHTAGDHCERCMAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQQVICH
CQPGYTGPRCEECAPGHFGDPLRPGGRCQPCECSSNIDPMDPEACDRQTGQCLRCLHNSE
GPRCAHCRLGYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPNIQGQS
CDRCAPNFWNLASGQGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQENHWGD
PGLQCRACDCDSRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGVFPACQPCHACFG
DWDRIVQGLASRTRALEQRARELHQLGALGAFEKNFRLLGEKLGTVQGIVNARNATAAAT
LQLMAITEDLRHDIEEATGQLTKLEGELTEAQDENFNANHALSGLERDGRALNLTLRQLG
QHLDVLKHSNFLGAYDSIRQSHAQSSEAEHRANRSALAVPGPVSDSAATRRRAEGLMGSQ
RDSFDRRNVANRRALGELAAKANSLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQR
RCGGLNCQGAAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLQAGVARQRAQAAL
EKANETRDRVERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPAQIHHL
ANEIAERVRSLGDVDTILQRTAGDVRQAEQLLQDAQQARTRAQSEKQKAEMVQDALEEAR
RAQGAAKGAIRGAAADTEGTEQTLGRVREKTAGAERDLSMATERTERLDAQLDALKLKRA
GNSLEATRAEETANSAQGRAQEAEQLLKGQLGDRYQTVRDLADRKAQGVLQAKERAERLR
DEARGLLQDAQDKLRRLHELEGTYEVNERALEGKAAQLDGLEAKMKDVLQSINQQIQIYN
TCQ
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgatcttggggcaccaagggtggggcctagggggactggagctgtggctgctg
ctggtcctaatcgccttgggagtggggagttttctctacgactgcttcctctccttagtg
ttggccaaggccccggcccagaaccccgacctgccttcagccggttgttccaggggaagc
tgctacccggccactggcgatctcctggttggcagagcagacagactgacagcctcgtcc
acctgcgggctcagaggccctgagccctactgtatagtcagccacctacaggatgaaaaa
aagtgtttcctgtgcgactctcggcatccattctctgcccgccaccctcaaagccaccga
atccagaacgtggtcaccagctttgccccccaacggcggtcagcctggtggcaatcagaa
aatggagtgtccaccgtcactatccagctggacttagaggctgaattccattttacccac
cttattatgaccttcaaggtcatctaccgcgtcctggacccggccatccccatcaccgat
ccctacagtccccggatccaggacctcctgaagatcaccaaccttcgggtgaacttgaca
cggcttcatactttgggggacaacctgctggacccccggagggagatccgggagaaatac
tattatgccctctacgagctggtggtccggggaaactgcttctgctacggccacgcgtcc
cagtgtgcccgggctcccggtgcccccgcccacgccgagggcatgnnnnnnnnnnnnnnn
nnnnnnnnngtgtccggccagtgtcgctgcaaggagcacgtggccggcccccgctgccag
cgctgccgagacggctacttcggcctgagcgccgcggacccgcagggctgccagaggtgc
cggggtgacccccggggcccagtgccggggggccctccttgtgacgccggcagcggggcc
tgcttctgcaaacgcctggtgacgggaaggcactgtgagcgatgcttggccgatcactgg
ggtctgagccatgacctactcggctgccgcccgtgtgactgtgatgtgggaggtgctctg
gaaccccggtgtgctgaggactcggggcagtgtcggtgtcgccgacacatgtttgggcga
cgctgcgaccaggtgcagcccggatacttcttgccattcttggaccatctcaccttcgag
gctgaggccgcccgtgggcaggccctggacataatcgagagaatggcacacccagggatg
gcagcctcctggacaggtgtgggctttgtgcggctgcgggagggtcagaccctcgagttt
gtggtggccacggtgtcccaggccatggactacgaactgctcctgcgatatgaacctcag
gtcccggagcagtgggcagaggtgactctgactgtgcagcggccagggcctatatctccc
agcagcccctgcggcaccactgtgcctgaggatgaccacttccgggggatgttgcagcct
gggaccagatatgtgctcctgccctctcccgtctgtctggagccggggctctcctacacg
attcgcctggagctgagccgggctggcggggatgtgcgccccggagccccccctcccggc
ctgctctttgactcagtgacctgccagtgtgacccccagggctccctgagctccgagtgc
caggcccacggtgggcagtgtccatgcaagccccatgtgactgggaggcgctgtcacccg
tgcgcgccaggaacctttggctttggtacttccggctgcagggcctgccagtgcagtccc
gagggcagtctcagcagtctgtgtcacgaggccagcgggcagtgcccctgccggcctgga
gcttttgggccacgctgtgatcggtgccagccggggcagtgggggttccccagctgccgc
ccttgtcactgtaacgggcacgcggacgattgtgacccaaggaccgggtcctgccagagc
tgccgggaccacacggcgggggaccactgtgaaaggtgcatggcaggcttctatgggaac
ccggtgctggcatcgggaggccactgccgcccctgcccttgccccgagggcccagggggg
cagcgacactttgctacctcctgccatcaggaccggcactcccagcaagtgatttgccac
tgccagcctggctacacgggcccacgctgtgaggagtgtgcccctggacactttggggac
ccactgaggccagggggccggtgccagccatgtgaatgcagcagcaacatcgatcccatg
gaccccgaggcctgtgaccgccaaactgggcagtgtttgcgctgtctccacaactcggaa
gggcctcgctgtgcccactgtcgccttggatactatgggcaggctgcccaccagagctgc
cggaggtgcacctgtaattttctgggcacagagcgcagtcaatgcccttctcaagacaaa
tgccgctgtgatccaggcagtgggcagtgcccatgcctacccaacattcagggacagagc
tgtgaccgttgtgcccccaacttttggaacctggcaagtgggcaaggctgccagccctgt
tcctgtcaccccagccatgctaccagtccttcctgcaatgagttcacagggcagtgtcat
tgccgagcaggctttggaggccgcacatgcactgagtgccaggagaaccactggggagat
cccggcctgcagtgtcgggcttgtgactgtgactcaagaggcattgagacccctcagtgc
caccatgccacagggcactgtgtctgccggccaggtgtggcaggtgtgcgctgtgaccag
tgtgcccgaggcttttcgggggttttccctgcatgccagccatgccatgcctgctttggg
gactgggaccggattgtgcaaggcctggcctcgcgcactcgcgctctcgaacagcgagct
cgggaattacaccagctgggggccctgggggcctttgagaagaatttccgcctgctggga
gagaagctgggcactgtgcagggcattgtgaatgcccgcaatgccacagctgccgccacc
ttgcagcttatggccattacagaagacttgaggcacgacattgaggaagctacaggacag
ctgactaagctggaaggagagctgacagaggcccaggatgagaacttcaatgccaaccat
gcccttagtggattggagcgagatggccgagctcttaaccttaccctaaggcagctgggc
cagcatctggacgtgctgaaacactccaacttcctgggggcctatgacagtatccgtcag
tcccacgctcagtcatctgaggcggagcatcgtgcaaatcgctcagccctggctgtccct
ggccctgtgagcgactcagcagctacacggcgccgagcagaaggcttgatgggcagccag
agagacagctttgaccggaggaatgtggccaaccggagggctctgggtgaacttgcagcc
aaggccaacagccttagcctgacgggcatcaatgagctggtatgtggggcccctggggat
gctccctgtgccacaagcccatgtggtggggctggctgcagggatgaggatggacagcgc
cgctgtgggggcctgaactgtcaaggagcagcagccacagcagacaatgcactgggccgg
gcgcggcacacacaggaggaattgcggcggaccctgggagatgcagatgggcttgtgggc
aaggtggcagaggcaaggctacaagcaggtgtggcccgacagcgagcacaggcagccctg
gaaaaggccaatgaaacccgggaccgagtggaaagggcaaaccaggaacttcgtgaactg
attcaaaatgtcaaggacttcttgagtcaagagggagctgaccctggtagcattgaggca
gtagccactcatgtgctggagctgtccatcccagcatcacctgctcagatccaccatctg
gcaaatgagattgctgagcgagtacggagcctcggggatgtggacaccattctgcagcgc
acagcgggggatgtgcgccaggctgagcaacttctgcaagatgcccagcaggcccggacc
cgggcccaaagtgagaagcagaaggcagagatggtgcaggatgctcttgaggaagcaaga
cgggcacagggtgcagcaaaaggcgctatccgtggggcagccgctgacacggagggcact
gagcaaacactgggcagggttcgggagaagacagctggagcagagcgggatttgagcatg
gcaacagagcgaaccgagaggttggatgctcagctggatgctttgaagttgaaaagggct
gggaatagcctggaagccacacgggctgaagagacagctaatagtgcccagggtcgggcc
caggaggctgagcagctgctgaagggccagctgggtgaccgataccagactgtgagggat
cttgctgatcggaaggcccagggtgtccttcaggctaaggagagagctgagcgtctacgg
gatgaggcccggggactgctacaggatgctcaagacaaacttcggagattgcatgagctg
gaaggcacatatgaagtgaatgaacgggccctggagggcaaagcagctcagttggatggc
ctggaggccaaaatgaaggatgtccttcagtccatcaatcagcagattcagatctacaac
acctgtcagtga

DBGET integrated database retrieval system