KEGG   Sarcophilus harrisii (Tasmanian devil): 100931469Help
Entry
100931469         CDS       T02286                                 

Gene name
LAMB2
Definition
(RefSeq) laminin, beta 2 (laminin S)
  KO
K06243  
laminin, beta 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100931469 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931469 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100931469 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100931469 (LAMB2)
   05222 Small cell lung cancer
    100931469 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    100931469 (LAMB2)
   05145 Toxoplasmosis
    100931469 (LAMB2)
Cell adhesion molecules and their ligands [BR:shr04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-11 Extracellular matrix (ECM) components
     100931469 (LAMB2)
    Laminin-14 Extracellular matrix (ECM) components
     100931469 (LAMB2)
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100931469 (LAMB2)
   VLA-6
      100931469 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1748 aa AA seqDB search
MRICDVRPSQGVGSLSLRYWITTAPHLSATNQVGHGFIVLLLLIQIPSACAHEIPDLLPP
PGCSGGSCYPPTGNLVVGRSQSLHASSTCGLRGPEPYCIVSHLQDSEKCFFCDSRGQGGH
RIKNVISLSGPDGERTWWQAESGVENVSIQLDLEGEFYFTHLIMTFKTFRPAGLLIERSA
DGGRSWRVYRYFAHNCSGLFPGIPLTPGRKVSDLVCDQRYSNIEPSSQGEVIFKVLDPAI
PVEDPYSPEIQELLRVTNLRVNFSKLHTLGDGPLGGWGHRHGPHYYYALYELVVRGSCLC
HGHASECAPAPGAPPSVEGMVHGLCVCQHQTAGPHCERCQDLFHDQPWRPAEPGNAHACR
ECECHQHARSCHFDMAVFVASGNVSGGVCDACQHHTAGRHCEICRPFYHRDPREDPRSPY
TCKPCDCDPSGTLDGGLCDTHTDEVRGLLSGQCRCKEHVAGPRCQRCRDGYFGLSAADPQ
GCQRCRGDPRGPVPGGPPCDAGSGACFCKRLVTGRHCERCLADHWGLSHDLLGCRPCDCD
VGGALEPRCAEDSGQCRCRRHMFGRRCDQVQPGYFLPFLDHLTFEAEAARGQALDIIERM
AHPGMAASWTGVGFVRLREGQTLEFVVATVSQAMDYELLLRYEPQVPEQWAEVTLTVQRP
GPISPSSPCGTTVPEDDHFRGMLQPGTRYVLLPSPVCLEPGLSYTIRLELSRAGGDVRPG
APPPGLLFDSVTCQCDPQGSLSSECQAHGGQCPCKPHVTGRRCHPCAPGTFGFGTSGCRA
CQCSPEGSLSSLCHEASGQCPCRPGAFGPRCDRCQPGQWGFPSCRPCHCNGHADDCDPRT
GSCQSCRDHTAGDHCERCMAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQ
QVICHCQPGYTGPRCEECAPGHFGDPLRPGGRCQPCECSSNIDPMDPEACDRQTGQCLRC
LHNSEGPRCAHCRLGYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPN
IQGQSCDRCAPNFWNLASGQGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQE
NHWGDPGLQCRACDCDSRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGVFPACQPC
HACFGDWDRIVQGLASRTRALEQRARELHQLGALGAFEKNFRLLGEKLGTVQGIVNARNA
TAAATLQLMAITEDLRHDIEEATGQLTKLEGELTEAQDENFNANHALSGLERDGRALNLT
LRQLGQHLDVLKHSNFLGAYDSIRQSHAQSSEAEHRANRSALAVPGPVSDSAATRRRAEG
LMGSQRDSFDRRNVANRRALGELAAKANSLSLTGINELVCGAPGDAPCATSPCGGAGCRD
EDGQRRCGGLNCQGAAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLQAGVARQR
AQAALEKANETRDRVERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPA
QIHHLANEIAERVRSLGDVDTILQRTAGDVRQAEQLLQDAQQARTRAQSEKQKAEMVQDA
LEEARRAQGAAKGAIRGAAADTEGTEQTLGRVREKTAGAERDLSMATERTERLDAQLDAL
KLKRAGNSLEATRAEETANSAQGRAQEAEQLLKGQLGDRYQTVRDLADRKAQGVLQAKER
AERLRDEARGLLQDAQDKLRRLHELEGTYEVNERALEGKAAQLDGLEAKMKDVLQSINQQ
IQIYNTCQ
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgtgatgttcggcccagccagggagtgggtagcctgagccttcggtactgg
ataaccactgctccccatctctcagccacaaaccaagtgggccacggcttcattgtgctg
ctgctgctaatacagataccctctgcctgtgcccatgaaatacctgatcttctgccccca
cctggctgctctggagggagctgttatcctcccactggcaatctagttgtgggcaggagc
cagagtctccatgcctcatccacctgtggtttaaggggacctgaaccctactgcattgtc
agccacttgcaggactctgagaaatgcttcttctgtgactcaagaggtcaaggaggccat
agaatcaagaatgtgatctccctcagtggacctgatggggaaagaacatggtggcaagct
gagagtggcgtggagaatgtcagtatccagctggacttggagggcgaattctacttcacc
caccttatcatgactttcaagacttttcgacctgctggtctactcattgagcgttcagcg
gatgggggtcgttcctggcgagtttatcgatactttgctcacaactgctctggcctcttc
cctgggattccacttacaccaggccgaaaagtcagtgatctcgtttgtgatcagcgttac
tcaaacattgaaccatcaagccagggtgaggtaatttttaaagttttggacccagccatc
cctgtggaggatccctatagtccagagatccaagagctgcttcgagttactaatctgagg
gtgaatttctctaaactacacacgttgggagatgggcccctagggggctggggccaccgt
cacggtcctcactactactatgctttgtatgagcttgtggtccgaggaagttgcctctgc
catggacatgcctctgagtgtgcacctgcccctggtgccccacccagtgtggagggcatg
gtccatgggctttgtgtttgtcagcaccagacagctggaccccactgtgagcgctgccag
gacctgttccatgaccagccctggcgcccagccgagcctgggaatgctcacgcctgccgg
gagtgtgaatgccaccagcatgccaggagttgccactttgacatggctgtttttgtggcc
tcgggcaacgtgagtggaggtgtgtgtgacgcatgtcagcaccacacagctggaaggcat
tgtgagatctgccgaccattctaccatcgggacccccgtgaagacccccgctccccatac
acctgtaaaccttgtgactgtgatccgtcaggcaccctggatgggggtctgtgtgacaca
cacacagatgaggtccgagggctcctctctggacagtgtcgctgtaaagagcacgtggcc
ggcccccgctgccagcgctgccgagacggctacttcggcctgagcgccgcggacccgcag
ggctgccagaggtgccggggtgacccccggggcccagtgccggggggccctccttgtgac
gccggcagcggggcctgcttctgcaaacgcctggtgacgggaaggcactgtgagcgatgc
ttggccgatcactggggtctgagccatgacctactcggctgccgcccgtgtgactgtgat
gtgggaggtgctctggaaccccggtgtgctgaggactcggggcagtgtcggtgtcgccga
cacatgtttgggcgacgctgcgaccaggtgcagcccggatacttcttgccattcttggac
catctcaccttcgaggctgaggccgcccgtgggcaggccctggacataatcgagagaatg
gcacacccagggatggcagcctcctggacaggtgtgggctttgtgcggctgcgggagggt
cagaccctcgagtttgtggtggccacggtgtcccaggccatggactacgaactgctcctg
cgatatgaacctcaggtcccggagcagtgggcagaggtgactctgactgtgcagcggcca
gggcctatatctcccagcagcccctgcggcaccactgtgcctgaggatgaccacttccgg
gggatgttgcagcctgggaccagatatgtgctcctgccctctcccgtctgtctggagccg
gggctctcctacacgattcgcctggagctgagccgggctggcggggatgtgcgccccgga
gccccccctcccggcctgctctttgactcagtgacctgccagtgtgacccccagggctcc
ctgagctccgagtgccaggcccacggtgggcagtgtccatgcaagccccatgtgactggg
aggcgctgtcacccgtgcgcgccaggaacctttggctttggtacttccggctgcagggcc
tgccagtgcagtcccgagggcagtctcagcagtctgtgtcacgaggccagcgggcagtgc
ccctgccggcctggagcttttgggccacgctgtgatcggtgccagccggggcagtggggg
ttccccagctgccgcccttgtcactgtaacgggcacgcggacgattgtgacccaaggacc
gggtcctgccagagctgccgggaccacacggcgggggaccactgtgaaaggtgcatggca
ggcttctatgggaacccggtgctggcatcgggaggccactgccgcccctgcccttgcccc
gagggcccaggggggcagcgacactttgctacctcctgccatcaggaccggcactcccag
caagtgatttgccactgccagcctggctacacgggcccacgctgtgaggagtgtgcccct
ggacactttggggacccactgaggccagggggccggtgccagccatgtgaatgcagcagc
aacatcgatcccatggaccccgaggcctgtgaccgccaaactgggcagtgtttgcgctgt
ctccacaactcggaagggcctcgctgtgcccactgtcgccttggatactatgggcaggct
gcccaccagagctgccggaggtgcacctgtaattttctgggcacagagcgcagtcaatgc
ccttctcaagacaaatgccgctgtgatccaggcagtgggcagtgcccatgcctacccaac
attcagggacagagctgtgaccgttgtgcccccaacttttggaacctggcaagtgggcaa
ggctgccagccctgttcctgtcaccccagccatgctaccagtccttcctgcaatgagttc
acagggcagtgtcattgccgagcaggctttggaggccgcacatgcactgagtgccaggag
aaccactggggagatcccggcctgcagtgtcgggcttgtgactgtgactcaagaggcatt
gagacccctcagtgccaccatgccacagggcactgtgtctgccggccaggtgtggcaggt
gtgcgctgtgaccagtgtgcccgaggcttttcgggggttttccctgcatgccagccatgc
catgcctgctttggggactgggaccggattgtgcaaggcctggcctcgcgcactcgcgct
ctcgaacagcgagctcgggaattacaccagctgggggccctgggggcctttgagaagaat
ttccgcctgctgggagagaagctgggcactgtgcagggcattgtgaatgcccgcaatgcc
acagctgccgccaccttgcagcttatggccattacagaagacttgaggcacgacattgag
gaagctacaggacagctgactaagctggaaggagagctgacagaggcccaggatgagaac
ttcaatgccaaccatgcccttagtggattggagcgagatggccgagctcttaaccttacc
ctaaggcagctgggccagcatctggacgtgctgaaacactccaacttcctgggggcctat
gacagtatccgtcagtcccacgctcagtcatctgaggcggagcatcgtgcaaatcgctca
gccctggctgtccctggccctgtgagcgactcagcagctacacggcgccgagcagaaggc
ttgatgggcagccagagagacagctttgaccggaggaatgtggccaaccggagggctctg
ggtgaacttgcagccaaggccaacagccttagcctgacgggcatcaatgagctggtatgt
ggggcccctggggatgctccctgtgccacaagcccatgtggtggggctggctgcagggat
gaggatggacagcgccgctgtgggggcctgaactgtcaaggagcagcagccacagcagac
aatgcactgggccgggcgcggcacacacaggaggaattgcggcggaccctgggagatgca
gatgggcttgtgggcaaggtggcagaggcaaggctacaagcaggtgtggcccgacagcga
gcacaggcagccctggaaaaggccaatgaaacccgggaccgagtggaaagggcaaaccag
gaacttcgtgaactgattcaaaatgtcaaggacttcttgagtcaagagggagctgaccct
ggtagcattgaggcagtagccactcatgtgctggagctgtccatcccagcatcacctgct
cagatccaccatctggcaaatgagattgctgagcgagtacggagcctcggggatgtggac
accattctgcagcgcacagcgggggatgtgcgccaggctgagcaacttctgcaagatgcc
cagcaggcccggacccgggcccaaagtgagaagcagaaggcagagatggtgcaggatgct
cttgaggaagcaagacgggcacagggtgcagcaaaaggcgctatccgtggggcagccgct
gacacggagggcactgagcaaacactgggcagggttcgggagaagacagctggagcagag
cgggatttgagcatggcaacagagcgaaccgagaggttggatgctcagctggatgctttg
aagttgaaaagggctgggaatagcctggaagccacacgggctgaagagacagctaatagt
gcccagggtcgggcccaggaggctgagcagctgctgaagggccagctgggtgaccgatac
cagactgtgagggatcttgctgatcggaaggcccagggtgtccttcaggctaaggagaga
gctgagcgtctacgggatgaggcccggggactgctacaggatgctcaagacaaacttcgg
agattgcatgagctggaaggcacatatgaagtgaatgaacgggccctggagggcaaagca
gctcagttggatggcctggaggccaaaatgaaggatgtccttcagtccatcaatcagcag
attcagatctacaacacctgtcagtga

DBGET integrated database retrieval system