KEGG   Sarcophilus harrisii (Tasmanian devil): 100931480Help
Entry
100931480         CDS       T02286                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin (serine/threonine kinase)
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway - mammal
Longevity regulating pathway - multiple species
Jak-STAT signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100931480 (MTOR)
   04630 Jak-STAT signaling pathway
    100931480 (MTOR)
   04066 HIF-1 signaling pathway
    100931480 (MTOR)
   04072 Phospholipase D signaling pathway
    100931480 (MTOR)
   04151 PI3K-Akt signaling pathway
    100931480 (MTOR)
   04152 AMPK signaling pathway
    100931480 (MTOR)
   04150 mTOR signaling pathway
    100931480 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100931480 (MTOR)
   04920 Adipocytokine signaling pathway
    100931480 (MTOR)
   04919 Thyroid hormone signaling pathway
    100931480 (MTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100931480 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100931480 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100931480 (MTOR)
   05230 Central carbon metabolism in cancer
    100931480 (MTOR)
   05231 Choline metabolism in cancer
    100931480 (MTOR)
   05206 MicroRNAs in cancer
    100931480 (MTOR)
   05205 Proteoglycans in cancer
    100931480 (MTOR)
   05214 Glioma
    100931480 (MTOR)
   05221 Acute myeloid leukemia
    100931480 (MTOR)
   05215 Prostate cancer
    100931480 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100931480 (MTOR)
   04931 Insulin resistance
    100931480 (MTOR)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100931480 (MTOR)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100931480 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 2373 aa AA seqDB search
MSGTVTILQQFASGLKSRSEETRAKTAKELQHYVTLELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEAYATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAM
AGDTCTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDTIF
VAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKGM
NRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITP
FTSFQAVQPQQSNALVGLLGYSAHQGIMGFGASPLPAKSTLVESRCCRDLMEEKFDQVCQ
WVLKCRSSKNSLIQMTILNLLPRLAAFQPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQ
ALGLLSVAVRSEFKVYLPRVLEIIRAALPPKDFAPKRQKAIQVDATVFTCISMLARAMGP
GIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAHQLASPSLTSLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLI
QILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVI
NNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDAAIREFLFQQLGMLV
SFVRSHIRPYMDEIVTLMREFWVMNSSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
LFMHDSSPGRTVSIKLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLAARKAALETVD
RLTESLDFTDYASRIIHPIVRTLDLSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDMLICRIVKGYTLADEEEDPLIYQHRMMRSNQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARPPKKL
PGIGEGSVILLDPGGLDFDSNDNGIVLLGERAAKCRAYAKALHYKELEFQKGPSPAILES
LIRTGFASTRQRGCVCRRLRMQKPSAVSGPFRGALSRARTVHKRALCPTVARISVVEIQA
TWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDE
IQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKA
RDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQ
RIVEDWQRILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDH
PLPTVHPQVTYAYMKHMWKSARKIDAFQHMQHFVQTAQQQAQHAIAAEDQQRKHELHKLM
ARCFLKLGEWQLNLQGINESTIPKVLQYYSASTEHDRSWYKAWHAWAVMNFEAVLHYKHQ
NQARDEKKKLRHASGASVTSAHTEGSNSESEAESADNSPVPSPVQKKVTEDLSKTLLMYT
VPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQ
LIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEH
SNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERG
PQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSL
ELQYVSPKLLMCRDLELDVEHGYRVRGAPAKPASGLRVTVLSSGASASTAVSFQMAPDYD
HLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGL
GDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNY
RITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGTKRSRTRTDSYSAGQSVE
LLDSVDLGETTHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHD
ETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7122 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaccgtgaccatcctccagcagtttgccagtggcttgaagagccgcagcgag
gagacgcgggccaaaactgccaaggagctgcagcattatgtcaccctggaactccgggag
atgagtcaggaggagtctacccggttctatgatcagttgaatcatcacatttttgaactg
gtgtccagctcagatgccaatgagcggaaagggggcatcctggccatagccagccttata
ggagtggaagcatatgctacccgcataggcaggtttgctaactaccttcggaacctcctt
ccctccaatgacccagttgtcatggagatggcatccaaggccatcggccgcctggccatg
gcgggagacacttgcacagctgagtatgtggagtttgaggtgaaacgggccctcgaatgg
ctgggtgccgaccgcaacgagggccggagacatgcagctgttcttgtccttcgtgagctg
gccatcagcgtccccaccttcttcttccagcaagtgcagcctttctttgatactatcttt
gtggcagtctgggaccccaaacaggccatccgggaaggagctgtctctgccctccgagcc
tgtctgatcctcaccacccagcgtgaaccgaaagagatgcagaaaccccagtggtacagg
cacacctatgaagaagcagagaagggctttgacgagacactggccaaggagaaaggcatg
aatcgggacgaccggattcatggggccttgctgattctcaatgagcttgtgaggatcagc
agcatggagggagagcgtctccgggaagaaatggaagaaataacccagcagcagctagtg
catgacaagtactgcaaagacctcatgggctttgggacaaaacctcgtcacatcactccc
ttcaccagcttccaggcagtgcagccccagcagtccaatgccctggtcggcctgctgggt
tacagtgcccaccaaggcattatgggatttggggcgtctcccctcccagccaaatccacc
ttggtggaaagccgatgttgcagagacctgatggaagagaaatttgatcaggtgtgccag
tgggtgctaaaatgccggagcagcaagaactccctcatccagatgaccatccttaatctg
ttgccccgcctggctgcgtttcagccatctgccttcactgatactcagtacctccaggac
accatgaaccatgttcttagttgcgtcaagaaggagaaggaacgcacagctgcttttcag
gccctcggcttgctctctgtggccgtgagatccgagtttaaggtctatttgcctcgtgtt
ctggagatcatccgagcagccctcccacccaaggactttgctcctaagaggcagaaggcc
attcaggtggatgccacagtcttcacctgtatcagcatgctggcccgagccatggggccc
ggcatccagcaggacatcaaggagctcctcgagcctatgctggctgtgggcctgagccct
gccctgactgctgtgctctatgacctgagccggcaaattccacagctgaagaaagacatc
caggatggcctgctcaagatgctgtccctggtgctcatgcacaaacccctccggcacccc
gggatgcccaagggcctggcccaccagttggcctcccctagcctcaccagccttccagag
gccagcgacgtagggagcatcactcttgccctgcgaacccttggtagctttgaatttgaa
ggccactctctgacccagtttgtccgccactgtgccgaccattttctgaacagcgagcac
aaggagatccgcatggaggctgcccgcacctgctcccgcctgctcacgccctccatccac
ctcatcagcggccacgcccacgtggtcagtcagacggctgtgcaggtggtagcggatgtg
ctcagcaaactgctggtggttggaataacggacccagaccctgacatccgttactgtgtc
ctggcctccctggatgagcgctttgatgctcacttggcccaggcagagaacctgcaagcc
ttgtttgtggccctgaatgaccaggtgtttgagatccgggagctggccatctgcaccgtg
ggccgcctcagcagcatgaaccctgcttttgtcatgcctttcctgaggaagatgctcatt
cagattttgaccgagctggaacacagtggagttggaagaatcaaggagcagagtgcccga
atgctggggcacttggtttccaatgccccccggcttattcgtccctacatggagcccatt
ctgaaggctttaattctgaagctgaaagatccagaccctgacccaaacccaggggtgatc
aataatgtcttggctacgataggagaactggcacaggtgagtggcctggaaatgcggaag
tgggtggatgagctctttatcatcatcatggacatgctgcaggactcttctcttctggcc
aagaggcaggctatccgagttttggggcttttgggtgctttagatccctacaagcacaaa
gtcaacatcggtatgattgatcagtctcgggatgcttctgccgtcagtttatctgagtcc
aagtccagccaggattcctccgactacagcaccagtgagatgctggtcaacatggggaac
ctgcctcttgatgagttctacccagccgtgtcgatggtggctctgatgaggatcttccgt
gaccaatccctctcccaccatcacaccatggtcgttcaggccatcactttcatctttaaa
tccctggggctcaagtgcgtccagttcctgccccaggttatgcccacgttcctcaacgtg
atccgagtctgtgatgctgccattcgggaatttctgttccagcagctggggatgctagtg
tcctttgtgaggagtcacatcaggccttacatggacgagatcgtcaccctcatgagagag
ttctgggtcatgaacagctccatccagagcacgatcatcctccttattgagcagattgtg
gtcgctctgggtggtgaattcaagctctacttgccccagctgattcctcacatgctgcgg
ctcttcatgcatgacagcagccctggacgcacggtctccatcaagttgttgaacgcaatt
cagctgtttggcgccaatctggatgactacctgcatttgctcttgcctccgattgtgaag
ctctttgatgctcctgatgttccattagcagcacgcaaggcagccttggagactgttgat
cgcttgaccgaatctctggatttcactgattacgcatcccgaatcatccaccccattgtg
cggacactggacctgagcccagagctgcgctccacagccatggacacattgtcttctctt
gtgttccagctggggaagaagtaccagatttttatcccaatggtgaataaagtgctggtg
agacacagaatcaaccatcagcgctacgacatgctcatttgtaggatcgtcaagggctat
acactagctgatgaggaagaagatcccttaatttatcagcaccgaatgatgaggagcaac
cagggcgacgccttggccagtgggccggtcgagacagggcccatgaagaagctgcatgtg
agcaccatcaacctgcagaaggcctggggagcagccaggagggtttccaaggatgattgg
ctggagtggctgagacggctgagcttggaattgctgaaggactcctcatctccgtccctc
cgctcctgctgggccttggctcaggcctacaaccctatggcgaggcctcctaagaagctg
cctggcattggagagggctcggtgatcctcttggatcctgggggtttggattttgattcc
aatgacaatggcatcgtgctgctgggtgagcgagcggccaagtgccgcgcctatgccaaa
gcgttacactacaaggagctggagttccagaagggccccagccccgccatcctcgagtct
ctcatcaggaccggctttgcgagtacaagacagcgcggctgtgtgtgccgcaggctcagg
atgcagaagcccagtgcagtgtcaggcccgttcagaggcgcgctgtcgagggctaggacc
gtccacaagagagccctgtgtccaacggtggctcgcatttctgtcgtggagatccaggct
acctggtatgaaaagcttcacgaatgggaagatgctctggtcgcttatgacaaaaagatg
gacacaaacaaagatgaccctgagttaatgctgggccggatgcgctgcctggaggccttg
ggagaatgggggcagctccatcagcagtgctgtgaaaagtggaccctggtcaacgatgag
atacaagctaaaatggcccgcatggctgctgcagctgcttggggtttaggtcaatgggac
agcatggaggagtatacctgtatgatccctcgggacacccatgatggggctttttacaga
gccgtgctggccctgcatcaggacctcttctcattggctcaacagtgcatcgacaaagcc
agggacctgctggatgctgagctaacggccatggcgggagaaagctacagccgagcctat
ggggcaatggtttcctgtcatatgctctcggagctggaggaagttatccagtataaactt
gtccccgaacggcgcgagatcatccgccagatctggtgggagaggctgcagggctgccag
cggattgttgaagattggcagagaatcctcatggtgcggtctctcgttgtcaacccccat
gaagatatgagaacttggcttaaatatgcaagtttatgtggcaagagtggaagattggca
cttgctcataaaactttagtattgctcctgggagttgacccttctcgacaactagaccat
ccactgccgactgtccatcctcaggtgacttatgcctacatgaagcacatgtggaagagt
gcacgaaagattgatgccttccagcacatgcagcactttgtgcagactgcccagcaacag
gcgcagcacgccatcgctgccgaggaccagcagcgcaagcacgagctccacaagctcatg
gcccggtgcttcttgaagctgggtgaatggcagctgaatctccaaggcatcaacgagagc
accatccccaaggtcttgcagtactacagtgcttccacggagcacgaccgcagctggtac
aaggcctggcacgcctgggcggtcatgaactttgaagccgtgctgcactacaagcaccag
aatcaggcccgagacgagaagaaaaagctccgtcatgccagtggggccagtgtcacaagt
gcccacacagagggcagcaacagcgagagtgaggcagagagcgccgacaacagccctgtg
ccctcacctgtgcagaaaaaggtcaccgaggatctgtccaagacgctcctgatgtacaca
gtgcctgcagtgcagggcttcttccgctccatctctctgtcccggggcaacaaccttcag
gacaccctcagagtcctcaccttgtggtttgactacggacactggccagacgtaaatgaa
gctcttgtggaaggggtgaaggcaatccagattgatacgtggttgcaggtcatcccacag
ctcattgcaagaatcgacactccgcggcccttggtgggacgccttattcatcagctgctc
acagacatcggtcgctaccatccccaggctctgatttaccccctaactgtggcctccaag
tccactaccacggcccgccacaatgcagccaacaagatcctgaagaacatgtgtgagcac
agcaacaccctggtccagcaggccatgatggtgagcgaagagctgatccgtgtggccatc
ctgtggcacgagatgtggcacgagggtctggaggaagcttctcgtttgtacttcggggag
aggaacgtgaaagggatgttcgaggtgcttgaacccctgcatgcaatgatggagcggggt
ccccagactctgaaggaaacctcctttaatcaggcgtatggccgagatttaatggaggcc
caagaatggtgtcggaagtacatgaagtcagggaatgtcaaggacctgacccaggcgtgg
gacctctattatcacgtgttccgacggatctccaagcaactgcctcagctcacttccctg
gagctgcagtacgtctcccccaagctcctgatgtgccgggacctggaactggatgtggag
cacggttacagggttagaggagcccctgcgaagcccgcgtccgggctccgtgtcactgtc
ctgtcatctggggcttcagcaagcacggctgtctcgtttcagatggctccggactatgac
cacttgactctgatgcagaaggtggaagtgtttgagcacgcagtcaacaacactgccggg
gacgacctggccaaactgctctggctgaagagccccagctccgaggtgtggtttgaccga
agaaccaactatacccgctctttagctgtcatgtcaatggttgggtacattttgggcctg
ggagacagacacccatccaacctgatgctggacaggctcagtgggaagatcttacacatc
gactttggggattgctttgaggtggcaatgactcgagagaagttccctgagaagattcca
tttagattgacaaggatgctgaccaatgcaatggaggtgaccggcctcgacggcaactac
cggatcacctgccacacagtgatggaagttcttcgggaacacaaggacagtgtgatggcc
gtgttggaagcctttgtgtatgatcccttattgaactggaggcttatggacacaaatacg
aaaggcactaagcgatcacgaacgcggacagactcctactcagctggccagtctgtagaa
ttactggacagcgtggatcttggggagaccacccataagaaaacggggaccacagtgccc
gagtccatccattcttttatcggggatggtttggtgaaacccgaggccctcaataagaag
gcaattcagattattaacagggttcgagataagctcacaggtcgagatttttctcatgat
gaaactttggacgttcctacacaagttgagctactgatcaagcaggccacgtcccacgag
aacctctgccagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system