KEGG   Sarcophilus harrisii (Tasmanian devil): 100931537Help
Entry
100931537         CDS       T02286                                 

Gene name
USP34
Definition
(RefSeq) ubiquitin specific peptidase 34
  KO
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100931537 (USP34)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100931537 (USP34)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100931537 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 3406 aa AA seqDB search
MRRKNSCYVWQKXFQIQFPLYTAYKHNTHPTIEDISAQESNILGAFCDMNDVEVPLHLLR
YVCLFCGKNGLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTY
VIRYLCKLSDQDLRQSAARNMADLMWSTVKEPLDTALCFDKESLDLAFKYFMSPTLTMRL
AGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLISNNVVEHIFGPNLHIEIIKQC
QVILNFLAAEGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSAL
HPSGHTEQTLYLASMLIKALWNNALAAKAQLSKQSSFASLLNTNLPMGNKKEEEELRRAA
PSPWSPAASPQSSDNSDTHQSGGSDIEMDEQLINRTKHVQQRLSDTEESLQGSSDETANS
GEDGSSGPGSSSGHSDGSSNEVNSSHASQSAGSPGSEVHSEDIADMEALKEEEEEDDHGH
DPSKSSHGTDLRNRKLESQAGICLADSQGPPERGSTNNGTGKDLVFNSDSVPSVDNRIRM
LDTCARPEDTEHDMAGEMSTAHISQASQDSCITRTGDFLGEAIGNELFNCRQFIGPQHHH
HHHHHHHHHHHHHHHHHHDGHVVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEE
LVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKHQYNSNAVTDINLDNVCKKGNTL
LWDLVQDEDAIHLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLANNRSVVVSLR
LLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQAVREGRHKHALYSHSA
EVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQH
AMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFW
GIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSNLEQESHSSLT
IIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRIVCQPAGLPD
KMTIEMYPSDQVADLRAEVTHWYENLQKEQISQQAQLQEFGQSSRKGEFPGGLMGPVRMI
SSGHELTTDYDEKTLHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPML
LLLQEPHLTTLFDLLEMLASFKPPSGEVTMEDIESARCEELHLHAENLSRRVWELLMLLP
TCPNMLQAFQTISDDQGNDGLNWKELLRIKSAHKLLYALEIIEALGKPNRRIRRESTGSY
SDLYPDSDDSSEDQIENSKNTWSCKFVAAGGLQQLLEIFNSGILEPKEQESWTVWQLDCL
ACLLKLICQFAVDPSDLDLAFHDVFAWSGVAESHRKRTWPSKSRKVTGDHSKGLHIPRLT
EVFLVLVQGTCLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVTHYSMWLLVSWAHCCSL
VKSSLADSDHLQDWLRKLTLLIPETAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAAST
LLKFLPDAQALKPIKIEDYEEEPVLIPGCKEYFWLLCKLIDNIHVKDASQTTLLDLDALA
RHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLF
LLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLLHNWVMAQHMQSSHSPYKWDY
WPHDDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQAIFTAKYSEDIKHKTTLLELQ
KMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTV
KSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYT
CSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTED
FLMGKCDRKEGFKEEVDLGKETESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNN
KWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEL
EEENGKDLKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSSIPSTLPDPKAVS
LMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQIL
IKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDGPVEDIGSRSCVTRFV
KTLLSIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPEN
PQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQNDM
AALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIISMLFTSIAKLTPEAAN
PFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVL
QNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTT
VVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWN
LFQPKLSEPAIATNHNKQALLSFWYNVCVDCPENVRLIVQNPVVTKNIAFNYILADHDDQ
DVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFN
LMQLFVAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLL
VIFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQAL
IQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYH
HSNIPMSLGPYFPCRENLKLMGGKSNIRPPRPELNMCLLPTMVETNKGKDDVYDRMLLDY
FFSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSK
NCIKLLCEDPVFAEYIKCILMDERTFLNNNFVYTFLTHFLLKVQGQVFSEANCANLISTL
ITNLINQYQSLQSDFTNRVEISKASSSLNGDLRALALLLSVHTPKQLNPALIPTLQELLS
KCRTCQQQRNSLQEQETKERKTKDDEEATPVKRRRVSSDEEHTVDSCISDMKTEPREVLT
PTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDISNIRSQHMEDQSSS
GKFEEVCREFKDPQSSKDSNITEEEPEFPSTSISAVLSDLTDLRNCDGQALSSQDPETSL
SLSCGHSRGLFSHVQQHDILDTLCRTIESTILVVTRIAGKGNQAAS
NT seq 10221 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggaaaaactcttgctatgtgtggcaaaaantctttcagattcagtttccctta
tatactgcttacaagcataacactcatcctacaatagaggatatttcagctcaagaaagc
aatatattaggggcgttctgtgatatgaatgatgtagaagtaccattgcacttgcttcgt
tatgtttgtttgttttgtggaaaaaatggcctttccctcatgaaggattgctttgaatat
ggaactcccgaaactttgccgtttctcatagcacatgcatttattacagttgtatctaat
attagaatatggctgcatatacctgctgtcatgcagcatattattccatttaggacctat
gttatcaggtatttatgcaaactttctgaccaggacttaagacagagtgctgctagaaac
atggctgatttaatgtggagcacagtgaaagaaccattggatacagccttatgctttgat
aaagaaagccttgatcttgcatttaaatactttatgtcacccacattgactatgaggttg
gctggactaagtcagataacaaatcagcttcacaccttcaatgatgtgtgcaataatgaa
tctttagtttcagacacagaaacgtcaattgcaaaagagcttgcagactggcttattagc
aacaatgttgttgagcatatatttggaccaaatttacatattgagattatcaaacagtgc
caagtgattttgaattttctggcagcagaaggacggctaagtactcagcacatagattgc
atttgggctgcagcacagttgaaacattgtagccggtacatacatgacttgtttccttcg
ctcatcaagaacttagatcctgttccacttagacatctcctcaatctggtttcagctctt
catccaagtggtcatactgaacaaaccttatatttggcatctatgcttattaaagcatta
tggaataatgcattagcagctaaggcccaactttcaaaacagagttcttttgcatcttta
ctcaatactaacctccctatgggaaataagaaagaggaagaagagctcagaagagcagcc
ccgtcgccttggtcacctgcagctagtcctcaaagcagtgataacagtgatacacatcaa
agtggaggcagtgatattgaaatggatgagcaacttattaacagaactaaacatgtgcag
cagcgactttctgacacagaggaatccttgcagggaagttctgatgaaactgctaatagt
ggtgaggatggaagtagtggccctggcagcagcagtgggcacagtgatgggtctagcaat
gaggtcaattctagtcatgctagccagtcggctggaagccctggaagtgaagtacactcg
gaggatattgcagacatggaagctctcaaagaagaagaagaagaagatgaccatggccat
gatccctctaaaagcagtcatggtacagaccttcgaaacagaaagcttgaatcacaggct
gggatttgtctggcagattcacagggccctccagagagaggcagcacaaacaatggaaca
ggaaaggaccttgtttttaacagtgactcggtaccatcagttgataatcgaatcagaatg
ttagatacctgtgcacgtcctgaagatacagaacatgatatggcaggagaaatgagcact
gcacatatatcacaagcatctcaggattcttgtatcacacgtactggggactttcttgga
gaagccattgggaatgaattatttaattgtcgacagtttattgggccacagcatcaccat
caccaccaccatcaccaccaccaccatcatcaccaccaccaccaccaccaccatgatggg
catgtggttgatgacatgctaagtgcagatgacgtcagttgcagtagttcccaggtcagt
gcaaaatcagaaaaaaatatggctgattttgatggtgaagaatctggatgtgaagaggaa
ttagtacagattaattcacatgcagaattaacatctcatctccaacagcatcttcctaat
ttagcatctatctaccatgaacatcttagtcaaggcccagctgttcataaacatcagtac
aatagcaatgctgttacagacattaatttggataatgtttgcaagaaaggaaatactttg
ttatgggatttagtccaagatgaagatgcaattcatctctcagaagggttaataaatgag
gcagagaaacttctttgctccttagtgtgctggtttacagatcgacagattcgaatgaga
ttcattgaaggctgtctagaaaatttagcaaacaacagatctgtagtagtctcacttcgt
cttcttccaaaattgtttggtactttccaacagtttgggagcagttatgatacacattgg
attacaatgtgggcagaaaaagaactaaacatgatgaagcttttctttgataatttggta
tactacattcaagctgtaagagaagggagacataaacatgccctgtatagtcacagtgca
gaggttcaagttcgacttcaattcttgacatgtgttttttccactcttggatcaccagat
cattttaggctaagtttagaacaagtcgacattttgtggcactgcttagttgaagattct
gagtgttatgatgatgcacttcactggtttttaaatcaagttcggagtaaagatcaacat
gcaatggggatggaaacttacaaacatctttttctagaaaagatgccacagctaaaacct
gaaactattagtatgactggtttaaacctgtttcagcatctttgcaacttggcacgactg
gctactagtgcatatgatggtggctccaactctgagttatgtggtatggaccaattctgg
ggcattgctttaagagcacagagtggtgatgttagtcgggcagctattcagtatatcaac
tcctattatattaatggtaaaacgggcttggaaaaagaacaagaatttattagtaagtgt
atggaaagccttatgatagcctccagtaatcttgaacaagaatcacactcaagtcttacc
attattgaaagaggacttcttatgctgaagacacatctggaagcattcagaagaagattt
gcttatcatctgcgacagtggcaaattgaaggcactggtattagtagtcatttaaaagcc
cttagtgacaaacagtcattaccactaagaattgtatgtcagccagctggccttcctgac
aagatgactattgaaatgtatcctagtgaccaggtagcagatcttagagcagaagtaact
cattggtatgaaaatttacagaaagagcagataagtcaacaagcacagcttcaagaattt
ggtcaaagcagcagaaagggagaatttcctggtggtctcatgggacctgttaggatgatt
tcatctgggcatgaactaacaacagactatgatgaaaaaacacttcatgaactgggattt
aaagatatgcagatggtctttgtatctctgggagcacccagacgagaaaggaaaggggaa
ggtgttcagttaccagcttcttgcctcccacctcctcagaaggacaacattccaatgctt
ttgcttttacaagagcctcatcttaccactctgtttgatttattagaaatgcttgcatca
tttaaacctccttctggagaagtgacaatggaagatattgagagtgcaagatgtgaagaa
cttcaccttcatgcagaaaatctctccagacgtgtctgggagttgctaatgcttcttcct
acatgtcctaacatgctacaggcattccaaacaatttcagatgatcagggtaatgatggg
cttaattggaaagaacttctaagaataaagagtgctcacaaattgttatatgcacttgaa
atcattgaagcattgggtaaacctaacagaagaataaggagagagtctacgggaagttac
agtgatctttatccagactctgatgattcaagtgaagatcaaatagaaaacagcaaaaat
acctggagctgcaagtttgttgctgctggaggacttcaacaattattagaaatctttaat
tctggaattctagagcctaaagagcaggaatcttggactgtgtggcagctagattgtctt
gcttgcttgctgaagttaatatgccagtttgcagtagatccatcagatttggatttagct
tttcatgatgtctttgcctggtctggtgtagcagaaagtcacaggaaaagaacttggcct
agtaaatcaaggaaagtaactggagatcacagcaagggtcttcatattccccgattaaca
gaggtatttcttgttcttgtgcaaggaacctgtttgattcagcggcttatgtcggttgct
tatacttatgataacttggcacctagagtcttgaaagctcaatctgaccacaggtcaaga
catgaagttacacattattcaatgtggctcttagtcagttgggctcattgctgttcttta
gtaaaatccagccttgccgacagtgatcatttacaggattggctgaggaaactgactctt
cttattcctgagactgctgttcgtcatgaatcttgcaatggtttatacaagttatcttta
tctggactggatggtggggattcaattaatagatcttttcttttacttgctgcctcaaca
ttattgaaatttcttcctgatgctcaggctttaaagcccattaagatagaggattatgaa
gaagaaccagtgctaatacctggatgtaaagaatacttttggttattatgcaaattaatt
gacaacatacatgtaaaagatgctagtcagacaactttactggacttagatgcgttggca
agacatctggctgactgtattcgaagcagagaaatccttgatcatcaggatggtaatata
gaagatgatgggcttacaggactcttaagacttgcaacaagtgttattaaacacaagcca
ccttttaagttttcacgggaaggacaggaatttctaagagacatcttcaatctgctcttc
ttgcttccaagcttaaaagatcgacaacagccaaagtgcaaatctcattcttcaagagct
gctgcttatgatttattagtagaaatggtaaaagggtcagttgagaactacaggcttcta
cacaactgggtaatggcccagcatatgcaatcatcccattccccttacaagtgggactat
tggcctcatgatgatgttcgagcagagtgtagatttgttggcctaactaatcttggagct
acttgttatttggcttctactattcagcaactctatatgatacctgaggctagacaagcc
atttttactgccaagtattcagaagatataaagcataagaccacacttctcgaacttcag
aaaatgtttacatatttaatggaaagtgaatgcaaagcttataatcctagacctttctgt
aaaacttatactatggataaacaaccactgaatactggtgaacaaaaagacatgaccgaa
ttcttcactgatttgataacaaaaattgaagaaatgtctccagaactgaaaaatacagtg
aaaagtttgtttggtggtgtcattacaaacaacgttgtttctttggattgtgaacatgtc
agtcagactgctgaagaattctatactgtgagatgccaggtggctgatatgaagaacatt
tatgaatctcttgatgaagtaactattaaagatacattagaaggtgacaacatgtatact
tgttctcattgtggaaagaaagtaagagctgaaaaaagggcatgttttaagaaattacct
cgcatcttgagtttcaatacaatgagatatacttttaatatggttaccatgatgaaggag
aaagtaaatacacatttttcattccctttacgtttggatatgactccttatacggaagat
tttcttatggggaagtgtgacagaaaagaaggttttaaggaagaagttgatcttgggaaa
gaaactgagagttatgagtatgatttgattggagtgacggttcatacaggaacagctgat
ggtggtcactattacagcttcattagggatatagtgaatccacatgcttataaaaacaac
aaatggtatctctttaatgatgctgaagtaaagccttttgattctgctcaacttgcttct
gaatgttttggtggggaaatgacaaccaagacctatgattctgttacagataagtttatg
gatttctcctttgaaaagacacacagtgcatacatgctattttataagcgaatggaactg
gaggaagaaaatggcaaagacctcaaatttgatgtttcatcagaattgttggagtggatt
tggcatgataacatgcaatttcttcaagacaagaacatttttgagcacacatattttggg
tttatgtggcagttatgtagtagtattccaagtacattgcctgatccaaaagctgtgtcc
ctaatgacagcaaagctaagtacttcttttgtcctggagacatttattcattccaaagaa
aagccgacaatgcttcagtggattgaattactgaccaagcagttcaataatagccaggcg
gcttgtgagtggtttttagaccgaatggctgatgatgattggtggccaatgcaaatctta
ataaagtgtcctaatcagattgtgagacagatgtttcagcgtttgtgtattcatgtgatt
cagagacttagacctgtacatgctcatctctatttacagccaggaatggaagatgggtca
gatgatatggatggtcctgtggaagatataggaagccgttcctgtgtcactagatttgta
aagaccttgttatcgattatggaacatggtgtgaagcctcatagtaaacatctcactgag
tacttcgccttcctttatgaatttgcaaaaatgggtgaagaagagagccaatttttgctt
tcattgcaagctatttcaacaatggtacatttctacatgggaaccaaagggcctgaaaat
cctcaagttgaagtgctatcagaagaagaaggagaagaggaagaagaggaagaagacata
ctgtctttagcagaagaaaaatataggcctgctgcacttgaaaagatgatagctttagtt
gctcttttggttgaacagtctcgctcagaaaggcatttaacattgtctcagaatgacatg
gcagcattaacaggtggaaagggatttcccttcttgtttcaacatattcgcgatggaatc
aatataagacaaacctgtaatctgattttcagcctttgtcgatataataatcgacttgca
gaacacattatttccatgcttttcacatccatagcaaagctgacacctgaggctgccaac
cctttctttaaattattaactatgttaatggagtttgctggtgggcctccaggaatgcca
ccatttgcatcttatattcttcagcggatatgggaggtgattgaatataacccttctcaa
tgccttgattggttggcagtgcagacaccccgtaataaattggcacatagttgggtgctc
cagaatatggaaaattgggttgagcgttttcttttggcacataattatcctcgagtcaga
acttctgcagcttatcttctggtatctttaattccaagcaattcattccgtcaaatgttc
cgctcaacaaggtctttgcacatcccgacacgtgacttaccactcagtccagataccaca
gtagttctgcatcaggtctacaatgtgcttcttggcttactttccagagccaaactttat
gttgatgctgctgttcatggcaccaccaagttggtgccctattttagtttcatgacatat
tgtctcatttccaaaacagagaagcttatgttttccacatatttcatggacttgtggaat
cttttccaacctaaactctctgagccagcaatagccaccaaccacaataagcaagctttg
ctttctttttggtacaatgtatgtgttgactgtccagagaacgtccgccttattgtgcag
aacccagtggtaaccaagaacattgccttcaattacatccttgctgaccatgatgatcag
gatgtggtgctttttaaccgtgggatgctgcctgcctactatggcattttgaggctctgc
tgtgagcaatcgcctgcatttaccagacagctagcatctcatcagaatattcagtgggcc
tttaagaatcttacaccacatgctagccagtaccctggagcagtggaagaactgtttaat
ttgatgcaattgtttgtagctcagagaccagatatgagagaggaggagttagaagatatt
aaacaatttaagaaaactactatcagttgttatttacgttgcttggatggccgctcctgc
tggacaaccttaataagtgccttcagaatactattagaatctgatgaagatagacttctt
gttatatttaatcgaggattaatcttgatgacagagtcattcaacacattacacatgatg
tatcatgaagccaccgcatgccatgtgactggagacttagtagaacttctgtccatattc
ctttcagttctgaagtctactcgcccttatcttcagagaaaagatgtgaaacaagcatta
attcagtggcaggaacgaattgaatttgcccataagctcttaactctgcttaattcatat
agtcctccagaacttagaaatgcatgcatagatgtccttaaggaacttgtgcttctgagt
cctcatgatttcctgcatactctagttccatttctacagcacaaccattgcacatatcac
cacagtaatattccaatgtcccttggaccttatttcccgtgtcgtgaaaatcttaaacta
atgggagggaaaagcaatatccgtccaccacgtcctgaactcaatatgtgcctcttgcct
acgatggtagaaaccaacaagggcaaagatgacgtttatgatcgtatgctgctagactac
ttcttttcttatcatcaattcatccatctattatgccgagttgcaatcaactgtgaaaaa
tttactgaaacattagttaagctgagtgtcctagttgcctatgaaggtttgccacttcat
cttgcactcttccccaaactttggactgagctatgccagactcagtctgctatgtcaaaa
aactgcattaagcttttatgtgaagatcccgttttcgcagagtacattaaatgtatccta
atggatgaaaggaccttccttaataacaactttgtatatacattcttgacccacttcctc
ttaaaggttcaaggtcaggtgttttctgaagcaaactgtgccaacttaattagcactctt
attacaaacttaataaatcagtatcagagcttacaatctgatttcaccaaccgagttgaa
atttccaaagcaagttcttccttaaatggggaccttcgagcacttgctttgctcctttcg
gtgcacactcccaaacagctgaacccagctctgatcccaactcttcaagagcttttaagc
aagtgcaggacttgtcaacaacaaagaaattcactccaagaacaagaaaccaaagaaagg
aaaactaaagatgatgaagaggcaactcctgttaaaagaagacgtgttagcagtgatgag
gaacatactgtagacagctgcatcagtgacatgaaaactgaaccaagggaggtattgact
ccaactagcacttcagataatgagacgagagactcttcaattattgatccaggcactgag
caagatcttccctcccctgaaaatagttctgtcaaagagtacagaatggaagttccatct
tcattttcagaagacatttcaaatatcaggtcacagcatatggaagatcagtccagcagt
ggcaagtttgaagaagtctgtcgagagtttaaagacccccagagttccaaggattctaac
ataactgaggaggaacctgagttcccttccacatcaatttctgcagttttgtcagactta
accgatttaagaaactgcgatggccaagctttgtcctcccaggatcctgagactagttta
tcacttagttgtggccattccagaggactctttagtcacgtgcagcaacatgacatttta
gacaccctgtgtaggaccatcgaatctacgattcttgtggtcacaaggatagctggcaaa
ggaaaccaagctgcttcttga

DBGET integrated database retrieval system