KEGG   Sarcophilus harrisii (Tasmanian devil): 100931537Help
Entry
100931537         CDS       T02286                                 

Gene name
USP34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100931537 (USP34)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100931537 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 3700 aa AA seqDB search
MRAGPSGAWWGLGTLSYLAGGEAAAPLADLGPPLNETSRGAGPMCSGKLSSLQVSINEVL
ISPSLLCLGEGRVKGSLSKLTGFLQLFSESLLGTCKFSVQVLRRDGFTTLLTNALVRVTT
STLFCPGVMMMVPSPAPLPFTVVTNFGELVLLLVLGCAVSDIEGGDGLQLRKEHTLKIFA
YINSWTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQALRDQLCKHCTINIDSTWQDQ
NNQAEEPLNVERESHEEENIERQKSEKKLDSTRICSLTEEESTKSSDPFNLWSTDEKEKL
LLCVAKIFQIQFPLYTAYKHNTHPTIEDISAQESNILGAFCDMNDVEVPLHLLRYVCLFC
GKNGLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLC
KLSDQDLRQSAARNMADLMWSTVKEPLDTALCFDKESLDLAFKYFMSPTLTMRLAGLSQI
TNQLHTFNDVCNNESLVSDTETSIAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNF
LAAEGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSALHPSGHT
EQTLYLASMLIKALWNNALAAKAQLSKQSSFASLLNTNLPMGNKKEEEELRRAAPSPWSP
AASPQSSDNSDTHQSGGSDIEMDEQLINRTKHVQQRLSDTEESLQGSSDETANSGEDGSS
GPGSSSGHSDGSSNEVNSSHASQSAGSPGSEVHSEDIADMEALKEEEEEDDHGHDPSKSS
HGTDLRNRKLESQAGICLADSQGPPERGSTNNGTGKDLVFNSDSVPSVDNRIRMLDTCAR
PEDTEHDMAGEMSTAHISQASQDSCITRTGDFLGEAIGNELFNCRQFIGPQHHHHHHHHH
HHHHHHHHHHHHDGHVVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINS
HAELTSHLQQHLPNLASIYHEHLSQGPAVHKHQYNSNAVTDINLDNVCKKGNTLLWDLVQ
DEDAIHLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLANNRSVVVSLRLLPKLF
GTFQQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQAVREGRHKHALYSHSAEVQVRL
QFLTCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMET
YKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFWGIALRA
QSGDVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSNLEQESHSSLTIIERGL
LMLKTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRIVCQPAGLPDKMTIEM
YPSDQVADLRAEVTHWYENLQKEQISQQAQLQEFGQSSRKGEFPGGLMGPVRMISSGHEL
TTDYDEKTLHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEP
HLTTLFDLLEMLASFKPPSGEVTMEDIESARCEELHLHAENLSRRVWELLMLLPTCPNML
QAFQTISDDQGNDGLNWKELLRIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPD
SDDSSEDQIENSKNTWSCKFVAAGGLQQLLEIFNSGILEPKEQESWTVWQLDCLACLLKL
ICQFAVDPSDLDLAFHDVFAWSGVAESHRKRTWPSKSRKVTGDHSKGLHIPRLTEVFLVL
VQGTCLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVTHYSMWLLVSWAHCCSLVKSSLA
DSDHLQDWLRKLTLLIPETAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLP
DAQALKPIKIEDYEEEPVLIPGCKEYFWLLCKLIDNIHVKDASQTTLLDLDALARHLADC
IRSREILDHQDGNIEDDGLTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFLLPSLK
DRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLLHNWVMAQHMQSSHSPYKWDYWPHDDV
RAECRFVGLTNLGATCYLASTIQQLYMIPEARQAIFTAKYSEDIKHKTTLLELQKMFTYL
MESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGG
VITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGK
KVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKC
DRKEGFKEEVDLGKETESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFN
DAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMELEEENGK
DLKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSSIPSTLPDPKAVSLMTAKL
STSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQ
IVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDGPVEDIGSRSCVTRFVKTLLSI
MEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVL
SEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQNDMAALTGG
KGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIISMLFTSIAKLTPEAANPFFKLL
TMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENW
VERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQV
YNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKL
SEPAIATNHNKQALLSFWYNVCVDCPENVRLIVQNPVVTKNIAFNYILADHDDQDVVLFN
RGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFV
AQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVIFNRG
LILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQER
IEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPM
SLGPYFPCRENLKLMGGKSNIRPPRPELNMCLLPTMVETNKGKDDVYDRMLLDYFFSYHQ
FIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLL
CEDPVFAEYIKCILMDERTFLNNNFVYTFLTHFLLKVQGQVFSEANCANLISTLITNLIN
QYQSLQSDFTNRVEISKASSSLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCQ
QQRNSLQEQETKERKTKDDEEATPVKRRRVSSDEEHTVDSCISDMKTEPREVLTPTSTSD
NETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDISNIRSQHMEDQSSSGKFEEV
CREFKDPQSSKDSNITEEEPEFPSTSISAVLSDLTDLRNCDGQALSSQDPETSLSLSCGH
SRGLFSHVQQHDILDTLCRTIESTILVVTRIAGKGNQAAS
NT seq 11103 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgggcctagtggggcctggtggggcctgggcactctcagttacctggcgggt
ggggaagcagcagctccactcgccgacttaggcccgcctttaaacgagacatctcgggga
gcggggcctatgtgctccgggaaactttcctcattacaggtgtcaattaacgaggtctta
attagcccctcactgctgtgcctgggggagggaagggtgaagggttcactgtccaagctt
acggggtttttgcagctgttttcagagagccttctaggcacctgtaagttttcagtccaa
gttctaaggagagatgggtttactactctcctgaccaatgctctggtgagagtgactaca
agcactcttttctgccctggagttatgatgatggtcccttcccctgcccctctccctttt
actgtggtcacaaactttggcgagctagtactccttctagtcctgggatgtgctgtatca
gacattgaaggtggtgatggactgcaactcagaaaggaacatactctcaaaatatttgct
tatatcaactcctggacacaaaggcaatgtctatgctgctttaaggagtataagcacttg
gagatttttaaccaagtagtatgtgctctcattaacttagtgattgcccaagttcaagcg
cttcgggaccagctctgtaaacattgcactattaacatagattcaacatggcaagatcag
aataatcaagctgaggagccattgaatgtagaaagagagtctcatgaagaagaaaatata
gaaagacaaaaatcagagaaaaaattagactctacaaggatttgtagcctgacggaggag
gagtctacgaagagttctgatccttttaatttatggagtacagatgagaaggaaaaactc
ttgctatgtgtggcaaaaatctttcagattcagtttcccttatatactgcttacaagcat
aacactcatcctacaatagaggatatttcagctcaagaaagcaatatattaggggcgttc
tgtgatatgaatgatgtagaagtaccattgcacttgcttcgttatgtttgtttgttttgt
ggaaaaaatggcctttccctcatgaaggattgctttgaatatggaactcccgaaactttg
ccgtttctcatagcacatgcatttattacagttgtatctaatattagaatatggctgcat
atacctgctgtcatgcagcatattattccatttaggacctatgttatcaggtatttatgc
aaactttctgaccaggacttaagacagagtgctgctagaaacatggctgatttaatgtgg
agcacagtgaaagaaccattggatacagccttatgctttgataaagaaagccttgatctt
gcatttaaatactttatgtcacccacattgactatgaggttggctggactaagtcagata
acaaatcagcttcacaccttcaatgatgtgtgcaataatgaatctttagtttcagacaca
gaaacgtcaattgcaaaagagcttgcagactggcttattagcaacaatgttgttgagcat
atatttggaccaaatttacatattgagattatcaaacagtgccaagtgattttgaatttt
ctggcagcagaaggacggctaagtactcagcacatagattgcatttgggctgcagcacag
ttgaaacattgtagccggtacatacatgacttgtttccttcgctcatcaagaacttagat
cctgttccacttagacatctcctcaatctggtttcagctcttcatccaagtggtcatact
gaacaaaccttatatttggcatctatgcttattaaagcattatggaataatgcattagca
gctaaggcccaactttcaaaacagagttcttttgcatctttactcaatactaacctccct
atgggaaataagaaagaggaagaagagctcagaagagcagccccgtcgccttggtcacct
gcagctagtcctcaaagcagtgataacagtgatacacatcaaagtggaggcagtgatatt
gaaatggatgagcaacttattaacagaactaaacatgtgcagcagcgactttctgacaca
gaggaatccttgcagggaagttctgatgaaactgctaatagtggtgaggatggaagtagt
ggccctggcagcagcagtgggcacagtgatgggtctagcaatgaggtcaattctagtcat
gctagccagtcggctggaagccctggaagtgaagtacactcggaggatattgcagacatg
gaagctctcaaagaagaagaagaagaagatgaccatggccatgatccctctaaaagcagt
catggtacagaccttcgaaacagaaagcttgaatcacaggctgggatttgtctggcagat
tcacagggccctccagagagaggcagcacaaacaatggaacaggaaaggaccttgttttt
aacagtgactcggtaccatcagttgataatcgaatcagaatgttagatacctgtgcacgt
cctgaagatacagaacatgatatggcaggagaaatgagcactgcacatatatcacaagca
tctcaggattcttgtatcacacgtactggggactttcttggagaagccattgggaatgaa
ttatttaattgtcgacagtttattgggccacagcatcaccatcaccaccaccatcaccac
caccaccatcatcaccaccaccaccaccaccaccatgatgggcatgtggttgatgacatg
ctaagtgcagatgacgtcagttgcagtagttcccaggtcagtgcaaaatcagaaaaaaat
atggctgattttgatggtgaagaatctggatgtgaagaggaattagtacagattaattca
catgcagaattaacatctcatctccaacagcatcttcctaatttagcatctatctaccat
gaacatcttagtcaaggcccagctgttcataaacatcagtacaatagcaatgctgttaca
gacattaatttggataatgtttgcaagaaaggaaatactttgttatgggatttagtccaa
gatgaagatgcaattcatctctcagaagggttaataaatgaggcagagaaacttctttgc
tccttagtgtgctggtttacagatcgacagattcgaatgagattcattgaaggctgtcta
gaaaatttagcaaacaacagatctgtagtagtctcacttcgtcttcttccaaaattgttt
ggtactttccaacagtttgggagcagttatgatacacattggattacaatgtgggcagaa
aaagaactaaacatgatgaagcttttctttgataatttggtatactacattcaagctgta
agagaagggagacataaacatgccctgtatagtcacagtgcagaggttcaagttcgactt
caattcttgacatgtgttttttccactcttggatcaccagatcattttaggctaagttta
gaacaagtcgacattttgtggcactgcttagttgaagattctgagtgttatgatgatgca
cttcactggtttttaaatcaagttcggagtaaagatcaacatgcaatggggatggaaact
tacaaacatctttttctagaaaagatgccacagctaaaacctgaaactattagtatgact
ggtttaaacctgtttcagcatctttgcaacttggcacgactggctactagtgcatatgat
ggtggctccaactctgagttatgtggtatggaccaattctggggcattgctttaagagca
cagagtggtgatgttagtcgggcagctattcagtatatcaactcctattatattaatggt
aaaacgggcttggaaaaagaacaagaatttattagtaagtgtatggaaagccttatgata
gcctccagtaatcttgaacaagaatcacactcaagtcttaccattattgaaagaggactt
cttatgctgaagacacatctggaagcattcagaagaagatttgcttatcatctgcgacag
tggcaaattgaaggcactggtattagtagtcatttaaaagcccttagtgacaaacagtca
ttaccactaagaattgtatgtcagccagctggccttcctgacaagatgactattgaaatg
tatcctagtgaccaggtagcagatcttagagcagaagtaactcattggtatgaaaattta
cagaaagagcagataagtcaacaagcacagcttcaagaatttggtcaaagcagcagaaag
ggagaatttcctggtggtctcatgggacctgttaggatgatttcatctgggcatgaacta
acaacagactatgatgaaaaaacacttcatgaactgggatttaaagatatgcagatggtc
tttgtatctctgggagcacccagacgagaaaggaaaggggaaggtgttcagttaccagct
tcttgcctcccacctcctcagaaggacaacattccaatgcttttgcttttacaagagcct
catcttaccactctgtttgatttattagaaatgcttgcatcatttaaacctccttctgga
gaagtgacaatggaagatattgagagtgcaagatgtgaagaacttcaccttcatgcagaa
aatctctccagacgtgtctgggagttgctaatgcttcttcctacatgtcctaacatgcta
caggcattccaaacaatttcagatgatcagggtaatgatgggcttaattggaaagaactt
ctaagaataaagagtgctcacaaattgttatatgcacttgaaatcattgaagcattgggt
aaacctaacagaagaataaggagagagtctacgggaagttacagtgatctttatccagac
tctgatgattcaagtgaagatcaaatagaaaacagcaaaaatacctggagctgcaagttt
gttgctgctggaggacttcaacaattattagaaatctttaattctggaattctagagcct
aaagagcaggaatcttggactgtgtggcagctagattgtcttgcttgcttgctgaagtta
atatgccagtttgcagtagatccatcagatttggatttagcttttcatgatgtctttgcc
tggtctggtgtagcagaaagtcacaggaaaagaacttggcctagtaaatcaaggaaagta
actggagatcacagcaagggtcttcatattccccgattaacagaggtatttcttgttctt
gtgcaaggaacctgtttgattcagcggcttatgtcggttgcttatacttatgataacttg
gcacctagagtcttgaaagctcaatctgaccacaggtcaagacatgaagttacacattat
tcaatgtggctcttagtcagttgggctcattgctgttctttagtaaaatccagccttgcc
gacagtgatcatttacaggattggctgaggaaactgactcttcttattcctgagactgct
gttcgtcatgaatcttgcaatggtttatacaagttatctttatctggactggatggtggg
gattcaattaatagatcttttcttttacttgctgcctcaacattattgaaatttcttcct
gatgctcaggctttaaagcccattaagatagaggattatgaagaagaaccagtgctaata
cctggatgtaaagaatacttttggttattatgcaaattaattgacaacatacatgtaaaa
gatgctagtcagacaactttactggacttagatgcgttggcaagacatctggctgactgt
attcgaagcagagaaatccttgatcatcaggatggtaatatagaagatgatgggcttaca
ggactcttaagacttgcaacaagtgttattaaacacaagccaccttttaagttttcacgg
gaaggacaggaatttctaagagacatcttcaatctgctcttcttgcttccaagcttaaaa
gatcgacaacagccaaagtgcaaatctcattcttcaagagctgctgcttatgatttatta
gtagaaatggtaaaagggtcagttgagaactacaggcttctacacaactgggtaatggcc
cagcatatgcaatcatcccattccccttacaagtgggactattggcctcatgatgatgtt
cgagcagagtgtagatttgttggcctaactaatcttggagctacttgttatttggcttct
actattcagcaactctatatgatacctgaggctagacaagccatttttactgccaagtat
tcagaagatataaagcataagaccacacttctcgaacttcagaaaatgtttacatattta
atggaaagtgaatgcaaagcttataatcctagacctttctgtaaaacttatactatggat
aaacaaccactgaatactggtgaacaaaaagacatgaccgaattcttcactgatttgata
acaaaaattgaagaaatgtctccagaactgaaaaatacagtgaaaagtttgtttggtggt
gtcattacaaacaacgttgtttctttggattgtgaacatgtcagtcagactgctgaagaa
ttctatactgtgagatgccaggtggctgatatgaagaacatttatgaatctcttgatgaa
gtaactattaaagatacattagaaggtgacaacatgtatacttgttctcattgtggaaag
aaagtaagagctgaaaaaagggcatgttttaagaaattacctcgcatcttgagtttcaat
acaatgagatatacttttaatatggttaccatgatgaaggagaaagtaaatacacatttt
tcattccctttacgtttggatatgactccttatacggaagattttcttatggggaagtgt
gacagaaaagaaggttttaaggaagaagttgatcttgggaaagaaactgagagttatgag
tatgatttgattggagtgacggttcatacaggaacagctgatggtggtcactattacagc
ttcattagggatatagtgaatccacatgcttataaaaacaacaaatggtatctctttaat
gatgctgaagtaaagccttttgattctgctcaacttgcttctgaatgttttggtggggaa
atgacaaccaagacctatgattctgttacagataagtttatggatttctcctttgaaaag
acacacagtgcatacatgctattttataagcgaatggaactggaggaagaaaatggcaaa
gacctcaaatttgatgtttcatcagaattgttggagtggatttggcatgataacatgcaa
tttcttcaagacaagaacatttttgagcacacatattttgggtttatgtggcagttatgt
agtagtattccaagtacattgcctgatccaaaagctgtgtccctaatgacagcaaagcta
agtacttcttttgtcctggagacatttattcattccaaagaaaagccgacaatgcttcag
tggattgaattactgaccaagcagttcaataatagccaggcggcttgtgagtggttttta
gaccgaatggctgatgatgattggtggccaatgcaaatcttaataaagtgtcctaatcag
attgtgagacagatgtttcagcgtttgtgtattcatgtgattcagagacttagacctgta
catgctcatctctatttacagccaggaatggaagatgggtcagatgatatggatggtcct
gtggaagatataggaagccgttcctgtgtcactagatttgtaaagaccttgttatcgatt
atggaacatggtgtgaagcctcatagtaaacatctcactgagtacttcgccttcctttat
gaatttgcaaaaatgggtgaagaagagagccaatttttgctttcattgcaagctatttca
acaatggtacatttctacatgggaaccaaagggcctgaaaatcctcaagttgaagtgcta
tcagaagaagaaggagaagaggaagaagaggaagaagacatactgtctttagcagaagaa
aaatataggcctgctgcacttgaaaagatgatagctttagttgctcttttggttgaacag
tctcgctcagaaaggcatttaacattgtctcagaatgacatggcagcattaacaggtgga
aagggatttcccttcttgtttcaacatattcgcgatggaatcaatataagacaaacctgt
aatctgattttcagcctttgtcgatataataatcgacttgcagaacacattatttccatg
cttttcacatccatagcaaagctgacacctgaggctgccaaccctttctttaaattatta
actatgttaatggagtttgctggtgggcctccaggaatgccaccatttgcatcttatatt
cttcagcggatatgggaggtgattgaatataacccttctcaatgccttgattggttggca
gtgcagacaccccgtaataaattggcacatagttgggtgctccagaatatggaaaattgg
gttgagcgttttcttttggcacataattatcctcgagtcagaacttctgcagcttatctt
ctggtatctttaattccaagcaattcattccgtcaaatgttccgctcaacaaggtctttg
cacatcccgacacgtgacttaccactcagtccagataccacagtagttctgcatcaggtc
tacaatgtgcttcttggcttactttccagagccaaactttatgttgatgctgctgttcat
ggcaccaccaagttggtgccctattttagtttcatgacatattgtctcatttccaaaaca
gagaagcttatgttttccacatatttcatggacttgtggaatcttttccaacctaaactc
tctgagccagcaatagccaccaaccacaataagcaagctttgctttctttttggtacaat
gtatgtgttgactgtccagagaacgtccgccttattgtgcagaacccagtggtaaccaag
aacattgccttcaattacatccttgctgaccatgatgatcaggatgtggtgctttttaac
cgtgggatgctgcctgcctactatggcattttgaggctctgctgtgagcaatcgcctgca
tttaccagacagctagcatctcatcagaatattcagtgggcctttaagaatcttacacca
catgctagccagtaccctggagcagtggaagaactgtttaatttgatgcaattgtttgta
gctcagagaccagatatgagagaggaggagttagaagatattaaacaatttaagaaaact
actatcagttgttatttacgttgcttggatggccgctcctgctggacaaccttaataagt
gccttcagaatactattagaatctgatgaagatagacttcttgttatatttaatcgagga
ttaatcttgatgacagagtcattcaacacattacacatgatgtatcatgaagccaccgca
tgccatgtgactggagacttagtagaacttctgtccatattcctttcagttctgaagtct
actcgcccttatcttcagagaaaagatgtgaaacaagcattaattcagtggcaggaacga
attgaatttgcccataagctcttaactctgcttaattcatatagtcctccagaacttaga
aatgcatgcatagatgtccttaaggaacttgtgcttctgagtcctcatgatttcctgcat
actctagttccatttctacagcacaaccattgcacatatcaccacagtaatattccaatg
tcccttggaccttatttcccgtgtcgtgaaaatcttaaactaatgggagggaaaagcaat
atccgtccaccacgtcctgaactcaatatgtgcctcttgcctacgatggtagaaaccaac
aagggcaaagatgacgtttatgatcgtatgctgctagactacttcttttcttatcatcaa
ttcatccatctattatgccgagttgcaatcaactgtgaaaaatttactgaaacattagtt
aagctgagtgtcctagttgcctatgaaggtttgccacttcatcttgcactcttccccaaa
ctttggactgagctatgccagactcagtctgctatgtcaaaaaactgcattaagctttta
tgtgaagatcccgttttcgcagagtacattaaatgtatcctaatggatgaaaggaccttc
cttaataacaactttgtatatacattcttgacccacttcctcttaaaggttcaaggtcag
gtgttttctgaagcaaactgtgccaacttaattagcactcttattacaaacttaataaat
cagtatcagagcttacaatctgatttcaccaaccgagttgaaatttccaaagcaagttct
tccttaaatggggaccttcgagcacttgctttgctcctttcggtgcacactcccaaacag
ctgaacccagctctgatcccaactcttcaagagcttttaagcaagtgcaggacttgtcaa
caacaaagaaattcactccaagaacaagaaaccaaagaaaggaaaactaaagatgatgaa
gaggcaactcctgttaaaagaagacgtgttagcagtgatgaggaacatactgtagacagc
tgcatcagtgacatgaaaactgaaccaagggaggtattgactccaactagcacttcagat
aatgagacgagagactcttcaattattgatccaggcactgagcaagatcttccctcccct
gaaaatagttctgtcaaagagtacagaatggaagttccatcttcattttcagaagacatt
tcaaatatcaggtcacagcatatggaagatcagtccagcagtggcaagtttgaagaagtc
tgtcgagagtttaaagacccccagagttccaaggattctaacataactgaggaggaacct
gagttcccttccacatcaatttctgcagttttgtcagacttaaccgatttaagaaactgc
gatggccaagctttgtcctcccaggatcctgagactagtttatcacttagttgtggccat
tccagaggactctttagtcacgtgcagcaacatgacattttagacaccctgtgtaggacc
atcgaatctacgattcttgtggtcacaaggatagctggcaaaggaaaccaagctgcttct
tga

DBGET integrated database retrieval system