KEGG   Sarcophilus harrisii (Tasmanian devil): 100931734Help
Entry
100931734         CDS       T02286                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100931734
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931734
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100931734
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100931734
   05222 Small cell lung cancer
    100931734
  Infectious diseases
   05146 Amoebiasis
    100931734
   05145 Toxoplasmosis
    100931734
Cell adhesion molecules and their ligands [BR:shr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100931734
   VLA-6
      100931734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1870 aa AA seqDB search
MRICDVRPSQGVGSLSLRYWITTAPHLSATNQVGHGFIVLLLLIQIPSACAHEIPDLLPP
PGCSGGSCYPPTGNLVVGRSQSLHASSTCGLRGPEPYCIVSHLQDSEKCFFCDSRGQGGH
RIKNVISLSGPDGERTWWQAESGVENVSIQLDLEGEFYFTHLIMTFKTFRPAGLLIERSA
DGGRSWRVYRYFAHNCSGLFPGIPLTPGRKVSDLVCDQRYSNIEPSSQGEVIFKVLDPAI
PVEDPYSPEIQELLRVTNLRVNFSKLHTLGDGPLGGWGHRHGPHYYYALYELVVRGSCLC
HGHASECAPAPGAPPSVEGMVHGLCVCQHQTAGPHCERCQDLFHDQPWRPAEPGNAHACR
ECECHQHARSCHFDMAVFVASGNVSGGVCDACQHHTAGRHCEICRPFYHRDPREDPRSPY
TCKPCDCDPSGTLDGGLCDTHTDEVRGLLSGQCRCKAHVWGPRCDTCRPGYYGLSPALPE
GCLSCRCDPRGTVPGDTPCDSISGDCYCKRFVTGQNCDQCLPEFWGLSSDFTGCRPCDCD
FGGAYSNRCSSGEGLCPCRPHLQGRDCLELQSGYFCAALDQAVAEAELGQRLRPSDARLP
GAPLPDAPPDCLPTTGPVLKRLRARLRRHRSTPCPPRSTRHGRQSHQAFKAVVEPRPWGR
GPPGSSWTGPGFARVEDRAGLMLQAPPVPRAMEYDIVLRYEAQAPEDWEALVSVRAYSLP
SSTRCANVLPSEQLYQVALPPRHRAVVLSRPFCFEPGTRYMVTLRLQRMTSARNLPGGTI
LLDSLVLLPRVEELPGLRRGDPGALGRLRELSRAQCLEAARTPYLGPPSESCARLVCSIS
ALLYSGGLACECDPQGSLSSECARVGGQCPCRPHVIGQRCDQCKPQTYGFGPAGCSECRC
SPEGSTSLTCDSLSGQCSCQPGITGRRCDRCLPGQWGFPHCQPCECNGHTEQCHPHTGAC
QACGDATTGRHCERCQDGYYGDPVLGSGQQCRPCPCPGFLGSGNYHATSCQADGGSERIL
CFCAPGYAGPRCDRCSAGYFGRPWPEGIVGGAPCRPCQCNNNIDPSDPMACDPHSGHCQR
CLHHTHGPHCSHCQPGYYGNALRPRGCRRCGCDQRGTVPGRCPPGSGICFCDRLSGHCPC
RPHVLGRLCDRCAPQFWNLGGPRGCEPCACHPQHSVQPACHLVTGQCPCREGFGGRTCSQ
CQEGYWGDPEKECRACACDPQGSISLRCHPRTGACSCLEGISGPRCKACARGSQGSFPHC
RPCPTCFSHWDGRLDALQQRLVTLAQGRDALREVATDWGSGGRLLALETAIGQVQGILVS
AHPLVGPSQQLMQQRDGLRREVSGLGRALRVTEKKVGMSMPWAGAQHSHFGQLTQEVDQL
SLLASQLKETPRGAQGTAQKGWGHFWGAVRKEATPHLPPPSPDAASLASRAALHSQEAEL
AVLATTALTDTESALSQSRQVRRRTEALLPKRKPPFGAPAWAHQLQGLVNASGALSPHAA
QLKVWGGLWGLGKACALSPCGPASCSGALPTSLWALGTARNTSRVLGATGIRLGRLHRRL
QRVGVTAGAAHSQAEETLSRARATWHGAGTAPILATIQRIRAFLTNEGADPESVELVAQR
VLKIPLPQGGRRAVEQLLEEIQDALQLPESMDWALPSAQGLLQQARWAREGTERTQDNVL
KTQGALTEAQNNIGRAERELRKTKQALKRLEAQTQEMALGLVQTTHDLDVGSTLDQLLGA
ADALQAQMSENKLKLRGAQEQAAQASDTAAHLGKELQTAKLQFSELQSGIDGLGDEVNGA
KSRLQRIHAEARELLKKASRSRNRLEGLEKRFARNEQALGEKAAELRALESRALGLLEQL
RQEASAHATC
NT seq 5613 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgtgatgttcggcccagccagggagtgggtagcctgagccttcggtactgg
ataaccactgctccccatctctcagccacaaaccaagtgggccacggcttcattgtgctg
ctgctgctaatacagataccctctgcctgtgcccatgaaatacctgatcttctgccccca
cctggctgctctggagggagctgttatcctcccactggcaatctagttgtgggcaggagc
cagagtctccatgcctcatccacctgtggtttaaggggacctgaaccctactgcattgtc
agccacttgcaggactctgagaaatgcttcttctgtgactcaagaggtcaaggaggccat
agaatcaagaatgtgatctccctcagtggacctgatggggaaagaacatggtggcaagct
gagagtggcgtggagaatgtcagtatccagctggacttggagggcgaattctacttcacc
caccttatcatgactttcaagacttttcgacctgctggtctactcattgagcgttcagcg
gatgggggtcgttcctggcgagtttatcgatactttgctcacaactgctctggcctcttc
cctgggattccacttacaccaggccgaaaagtcagtgatctcgtttgtgatcagcgttac
tcaaacattgaaccatcaagccagggtgaggtaatttttaaagttttggacccagccatc
cctgtggaggatccctatagtccagagatccaagagctgcttcgagttactaatctgagg
gtgaatttctctaaactacacacgttgggagatgggcccctagggggctggggccaccgt
cacggtcctcactactactatgctttgtatgagcttgtggtccgaggaagttgcctctgc
catggacatgcctctgagtgtgcacctgcccctggtgccccacccagtgtggagggcatg
gtccatgggctttgtgtttgtcagcaccagacagctggaccccactgtgagcgctgccag
gacctgttccatgaccagccctggcgcccagccgagcctgggaatgctcacgcctgccgg
gagtgtgaatgccaccagcatgccaggagttgccactttgacatggctgtttttgtggcc
tcgggcaacgtgagtggaggtgtgtgtgacgcatgtcagcaccacacagctggaaggcat
tgtgagatctgccgaccattctaccatcgggacccccgtgaagacccccgctccccatac
acctgtaaaccttgtgactgtgatccgtcaggcaccctggatgggggtctgtgtgacaca
cacacagatgaggtccgagggctcctctctggacagtgtcgctgtaaagcccacgtgtgg
gggcctcgctgtgacacctgtcgtcctggttattatggtctgagtccagcattacctgaa
ggttgtttgtcctgcaggtgtgatcctcggggcacagtcccaggtgacactccttgtgac
tccatcagtggtgactgctattgcaaacgttttgtcactggacagaactgtgaccagtgc
ctgccagaattctggggactgagcagcgactttactggttgccggccttgcgattgtgat
tttggtggcgcttacagcaacaggtgctcatcaggggaggggctttgtccttgtcgcccc
cacttgcaaggccgagactgccttgagctccagtctggttacttctgtgcagccttggac
caggccgtagccgaggcggagcttgggcagaggctcagaccctccgacgcccggctgcct
ggagcccctctacccgatgcccctcctgactgcctgccaacaacaggacctgtgctgaag
aggcttagagcccggctccggcgtcatcgaagcaccccctgccctccccgcagtactcgc
catggacgccagagccatcaagctttcaaggctgttgtggagccccggccttggggcaga
ggccctcctggctcctcctggactggccctggatttgccagggtggaggacagagctggc
ctcatgctccaggcccctccagtgccacgagccatggagtatgacattgtgctgcgctac
gaagctcaggcccccgaggactgggaggcccttgtcagtgtccgtgcctactccctgccc
agcagcacccgttgtgccaatgtgttgccctcagagcagctctatcaggtggccttaccc
cccaggcacagagctgtggtcctgtctagacccttctgctttgaacctggaaccagatac
atggtgaccttgagactacagcgaatgacaagtgcacggaacctccctgggggaaccatt
ctgctagactcgctagtacttctgcctcgagtagaggagcttccaggtctaagaaggggg
gaccctggggcattggggcgcctgagagaactcagtcgagctcaatgccttgaagctgca
agaacaccctaccttgggcccccttcagaatcctgtgcccgcttggtctgtagcatctct
gctctgctatatagtggtggcctagcctgtgagtgtgacccacaggggtctctgagctct
gagtgtgcccgtgtggggggccagtgtccatgtcgaccccacgtcatcggccagcgctgt
gaccagtgtaaaccacagacctacggctttggcccagcaggctgcagtgaatgtcgctgc
tcccctgagggctccaccagtttgacctgtgattctttaagcggccagtgctcgtgccag
ccgggaatcacaggacgaaggtgcgaccggtgcctgcctggccagtggggcttccctcat
tgccagccctgcgaatgcaacgggcatacagagcagtgccacccacacactggggcgtgc
caggcctgcggagacgccaccactgggcgccactgtgaaaggtgccaggatggttattat
ggagatcctgtcctgggctcaggacagcaatgccggccttgcccctgccctggcttcctg
ggctctggaaattaccacgcaacctcatgtcaggcggacggtggtagtgaacggatcctg
tgtttctgtgcacctggttatgcaggtcctcgctgtgaccgctgctctgctggctacttt
gggcgtccctggccagagggaatagttggtggggcaccgtgccgaccctgccagtgcaac
aacaacattgaccctagcgatcccatggcctgtgacccccacagtgggcactgccagcgc
tgtctacaccacacccatgggccacactgttcccactgccagcctggctactatggcaat
gccctccggccacgaggctgccggcgttgcggctgtgaccaacgaggcacagtacctggc
cggtgcccgcccggaagtggcatctgcttctgtgacaggctcagcggtcactgcccctgc
cgcccacatgtgctggggcggctttgtgaccgctgtgcccctcagttctggaacctgggc
gggcctcggggctgcgagccttgtgcttgtcacccccagcactcggtgcagccggcctgt
cacctggtaactggtcagtgcccatgccgggaaggatttgggggacgtacgtgctcccag
tgccaagaagggtactggggggacccagagaaggagtgcagagcctgtgcctgtgaccct
cagggttcaatctctctccgttgccaccctaggacaggggcttgctcgtgccttgaaggc
atttcaggccctcggtgcaaagcctgtgcccggggttcccagggcagtttcccccactgc
cgtccctgtccaacctgcttctctcactgggatggacgactggatgccctccagcagcgg
ctggtcacattggctcaggggagggatgccctgcgtgaggtggctactgactggggcagt
ggtgggcggctgctggccctggagacagccatagggcaggtccagggaatcctggtgtcc
gcccaccccctggtggggccctcgcagcagctcatgcaacagcgggatggactcaggagg
gaggtgtccggactgggccgggcccttcgagtgacagagaagaaggtggggatgagcatg
ccctgggccggggctcagcactcccacttcggccagctgacgcaagaagtggatcagctc
agcctcttggcctcccagctcaaggagaccccgagaggagcccagggtacggcccagaag
ggctggggacacttctggggagcagtcaggaaggaggccactcctcacctgccacctcct
tccccagatgctgcttcccttgcctccagggctgctctgcactcgcaggaggctgagctg
gctgttctggccaccacagccctgacagacaccgagagtgccctgagccagtcccggcag
gtcagacgccggacggaggcactgctgccaaagaggaagcctccctttggtgcgcctgcc
tgggcccaccagctccaggggcttgtgaatgcctccggggctctgagcccccacgcggcc
cagctcaaggtctgggggggactgtggggcctggggaaggcctgtgctctctccccttgt
gggccagcctcttgttctggggcactgcccacttccctgtgggcactgggaactgctcgc
aacacatcccgtgttctgggtgctacgggtatcaggctggggcggctacaccgacggctc
caacgggttggggtcacagcaggggctgcccactctcaggccgaggagacgctgagccga
gcccgagccacctggcatggggctggcaccgctcccatcttggccaccatccagaggatt
cgggccttccttacaaatgaaggggcagaccctgagagcgtagagctggtggcccagagg
gtcctgaaaattcctttgccccagggaggccggagagctgtagaacagctgttggaggag
atccaagatgccctgcagcttccagagagcatggactgggctctaccttcagcccagggc
ctccttcagcaagcacggtgggccagggagggtacagagagaacccaggacaatgtttta
aagacccagggagctctaactgaggctcagaacaacataggcagagctgagagagagctg
cggaagacaaagcaggcactgaagaggctagaggctcagacgcaggagatggcattagga
ctagttcagaccacacatgatctggatgtgggctccaccttggatcagctgctgggggca
gcagatgctctgcaggcccagatgtcagaaaataaactgaagctgaggggagcccaggag
caagcggcacaggcatcagacacagctgcacatttgggcaaggagctgcagacagccaaa
ttacagttctcagaattgcaatctgggattgatggccttggggatgaagtgaatggggcc
aaaagtcgcttgcagcggattcatgcagaagcccgggagctgctgaagaaagcaagcagg
agccggaaccgcctagaggggctggagaaacgctttgcccggaatgagcaggcgctggga
gagaaggcagcggagctccgggccctggagagcagagccctggggctgctggagcagctg
aggcaggaagccagcgcccacgccacctgctga

DBGET integrated database retrieval system