KEGG   Sarcophilus harrisii (Tasmanian devil): 100931776Help
Entry
100931776         CDS       T02286                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  
integrin beta 8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100931776 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931776 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100931776 (ITGB8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100931776 (ITGB8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100931776 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100931776 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100931776 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100931776 (ITGB8)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100931776 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 735 aa AA seqDB search
MLLKILGSGQSKENRCTSSNAATCTKCLGLGPECGWCAQEDFMAGAAASERCDIVSNLVS
KGCLSDFIESPSVAVTIPTGGEVNTQVSPREVLIQLRPGAEASFMLKIHPLQKYPVDLYY
LVDVSASMHNNIEKLNSVGNDLSQKMAPFSHDFRLGFGSYVDKTVSPYISIHPGRIHNQC
SDYNLDCMPPHGYIHVLSLTENITEFERAVDRQKISGNIDTPEGGFDAMLQAAVCQSHIG
WRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGKCHLKDNVYVKSTTMEHPSLGQLAEK
LIDNNINVIFAVQGKQFHWYKDLLPLLPGTVAGQIESKAANLNNLVVDAYQKLISEVRVQ
VENQIQGVHFTITAICPDGSRHTGMEGCRNVTSSDEVLFNITVTMDRCDRAGGRDYAIIR
PIGFNESTKVHIYRNCSCQCDDGRSPKQKCVDESLLEPTCPQCDGDKCQFDEDKSPLDSC
KAQKNQPICSGQGVCICGKCFCHKTKLGKVYGKYCEMDDFSCPYHHGNLCAGHGECEGGR
CKCFHGWEGDRCQCPSSSAQHCVNSKGQVCSGRGTCVCGKCECTDPRIVGRFCEYCPTCD
TACDENRNCVQCHHPHNLSQAILDQCRGSCPPRAHYIGQIEECFSSPSHFRIFFIIFIIT
FLIGLLKVLIIRQIILQRTRNKVKSASYRVSTSKKDKMFLPAVCTHTVTYRRDKPDEINI
DISKLHPHETFKCNF
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgttactaaaaatcttagggagtggccagagcaaagagaacagatgtaccagctcgaat
gcagcaacatgtaccaagtgcctggggctgggtccggagtgtggatggtgtgcccaagag
gatttcatggctggagcagcagcgagtgaacggtgtgacattgtttccaacttagtaagc
aaaggctgcttgtccgattttatagaatccccttcggttgctgtgacgatacccacggga
ggtgaagtgaatactcaagtcagccctcgggaggtgctcatccagctgcgaccaggagct
gaagctagttttatgctgaaaatccaccccctacagaaataccctgtggatctttattat
ctcgttgatgtctcagcctccatgcacaataatatcgaaaaactaaactcggttggaaat
gacttatctcagaaaatggcacctttttcccacgactttcgactcggatttggatcctac
gttgataaaacagtgtctccctatattagcatccaccctggcagaatccacaaccagtgc
agcgattacaatttagattgcatgccacctcatggctacattcacgtgctgtctctgaca
gagaacatcacggagttcgagcgagcggttgacagacagaaaatctcagggaatatcgat
acacccgaaggcggttttgacgccatgctccaggcggcagtttgccagagtcatattggt
tggcgcaaggaagctaaaagattgcttcttgtgatgacagatcagacttctcaccttgcc
cttgacagcaaacttgcagggatcgtggtgccaaatgacggaaaatgccatctaaaagac
aacgtctacgtgaagtccacaaccatggagcatccctcactgggtcaacttgcagaaaaa
ttaatagacaacaatattaatgttatttttgcagtccaaggaaaacagtttcattggtac
aaggatctcctgcccctcttacctggcaccgtggctggccaaattgaatcaaaagcagca
aacctcaacaacttggtggtggatgcctatcagaaactgatttccgaagtgagagttcag
gtggagaatcagatacaaggagtccattttaccatcacagccatctgtcctgatgggagc
agacatacagggatggaaggatgcagaaatgtgaccagcagcgatgaagttctgtttaat
atcactgtgaccatggacagatgtgatagagctggtgggagagattatgccatcatcagg
cctattggtttcaacgaaagtaccaaagtccacatctataggaactgtagctgccaatgt
gatgatggtagaagccccaaacagaaatgcgtagatgaaagtctcttagagcctacttgt
ccccaatgtgatggtgacaagtgccaatttgatgaagacaaatctcctctagacagttgc
aaggcacaaaaaaaccagcccatttgcagtggtcaaggtgtctgcatatgtgggaaatgt
ttctgtcacaaaactaaacttggaaaagtatatggaaaatactgtgaaatggatgacttt
tcctgcccatatcaccatggaaacctgtgtgctgggcatggggaatgtgaaggaggtcga
tgcaagtgcttccatggttgggaaggagaccgttgccaatgtccatcctcctctgcccaa
cattgtgtcaattccaagggccaggtgtgcagtgggagagggacttgtgtgtgtgggaag
tgcgaatgcaccgatcctcggatcgttggccgtttctgtgaatattgccccacctgtgat
acagcctgtgatgaaaatcggaattgtgtccaatgccaccatcctcacaatttatctcaa
gctatacttgatcaatgcagaggctcgtgtcctccaagagcccattatattggccaaata
gaagaatgtttctctagcccaagccactttcgaatatttttcatcatcttcatcatcacc
ttccttattggattattgaaggttctcatcatcagacagatcatcctccagaggaccaga
aataaagtgaaatctgccagttacagagtgtccacatcaaagaaggataagatgtttctg
cctgcagtttgcacgcacacggtcacgtatcgccgtgataaacccgacgagataaacatc
gacatcagtaaattgcaccctcatgaaacttttaagtgcaacttctaa

DBGET integrated database retrieval system