KEGG   Sarcophilus harrisii (Tasmanian devil): 100931776Help
Entry
100931776         CDS       T02286                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04514  Cell adhesion molecules (CAMs)
shr04810  Regulation of actin cytoskeleton
shr05165  Human papillomavirus infection
shr05410  Hypertrophic cardiomyopathy (HCM)
shr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
shr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100931776 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100931776 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100931776 (ITGB8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100931776 (ITGB8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100931776 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100931776 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100931776 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100931776 (ITGB8)
  Infectious diseases
   05165 Human papillomavirus infection
    100931776 (ITGB8)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100931776 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Tmemb_18A
Motif
Other DBs
NCBI-GeneID: 100931776
NCBI-ProteinID: XP_012406895
Ensembl: ENSSHAG00000000868
Position
5
AA seq 755 aa AA seqDB search
MWKVRYENGKEQRTTGSVSFMLLKILGSGQSKENRCTSSNAATCTKCLGLGPECGWCAQE
DFMAGAAASERCDIVSNLVSKGCLSDFIESPSVAVTIPTGGEVNTQVSPREVLIQLRPGA
EASFMLKIHPLQKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSQKMAPFSHDFRLGFGSY
VDKTVSPYISIHPGRIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVDRQKISGNID
TPEGGFDAMLQAAVCQSHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGKCHLKD
NVYVKSTTMEHPSLGQLAEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTVAGQIESKAA
NLNNLVVDAYQKLISEVRVQVENQIQGVHFTITAICPDGSRHTGMEGCRNVTSSDEVLFN
ITVTMDRCDRAGGRDYAIIRPIGFNESTKVHIYRNCSCQCDDGRSPKQKCVDESLLEPTC
PQCDGDKCQFDEDKSPLDSCKAQKNQPICSGQGVCICGKCFCHKTKLGKVYGKYCEMDDF
SCPYHHGNLCAGHGECEGGRCKCFHGWEGDRCQCPSSSAQHCVNSKGQVCSGRGTCVCGK
CECTDPRIVGRFCEYCPTCDTACDENRNCVQCHHPHNLSQAILDQCRGSCPPRAHYIGQI
EECFSSPSHFRIFFIIFIITFLIGLLKVLIIRQIILQRTRNKVKSASYRVSTSKKDKMFL
PAVCTHTVTYRRDKPDEINIDISKLHPHETFKCNF
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggtgaggtatgagaatggcaaggagcagcgaacgacaggatcagtatccttt
atgttactaaaaatcttagggagtggccagagcaaagagaacagatgtaccagctcgaat
gcagcaacatgtaccaagtgcctggggctgggtccggagtgtggatggtgtgcccaagag
gatttcatggctggagcagcagcgagtgaacggtgtgacattgtttccaacttagtaagc
aaaggctgcttgtccgattttatagaatccccttcggttgctgtgacgatacccacggga
ggtgaagtgaatactcaagtcagccctcgggaggtgctcatccagctgcgaccaggagct
gaagctagttttatgctgaaaatccaccccctacagaaataccctgtggatctttattat
ctcgttgatgtctcagcctccatgcacaataatatcgaaaaactaaactcggttggaaat
gacttatctcagaaaatggcacctttttcccacgactttcgactcggatttggatcctac
gttgataaaacagtgtctccctatattagcatccaccctggcagaatccacaaccagtgc
agcgattacaatttagattgcatgccacctcatggctacattcacgtgctgtctctgaca
gagaacatcacggagttcgagcgagcggttgacagacagaaaatctcagggaatatcgat
acacccgaaggcggttttgacgccatgctccaggcggcagtttgccagagtcatattggt
tggcgcaaggaagctaaaagattgcttcttgtgatgacagatcagacttctcaccttgcc
cttgacagcaaacttgcagggatcgtggtgccaaatgacggaaaatgccatctaaaagac
aacgtctacgtgaagtccacaaccatggagcatccctcactgggtcaacttgcagaaaaa
ttaatagacaacaatattaatgttatttttgcagtccaaggaaaacagtttcattggtac
aaggatctcctgcccctcttacctggcaccgtggctggccaaattgaatcaaaagcagca
aacctcaacaacttggtggtggatgcctatcagaaactgatttccgaagtgagagttcag
gtggagaatcagatacaaggagtccattttaccatcacagccatctgtcctgatgggagc
agacatacagggatggaaggatgcagaaatgtgaccagcagcgatgaagttctgtttaat
atcactgtgaccatggacagatgtgatagagctggtgggagagattatgccatcatcagg
cctattggtttcaacgaaagtaccaaagtccacatctataggaactgtagctgccaatgt
gatgatggtagaagccccaaacagaaatgcgtagatgaaagtctcttagagcctacttgt
ccccaatgtgatggtgacaagtgccaatttgatgaagacaaatctcctctagacagttgc
aaggcacaaaaaaaccagcccatttgcagtggtcaaggtgtctgcatatgtgggaaatgt
ttctgtcacaaaactaaacttggaaaagtatatggaaaatactgtgaaatggatgacttt
tcctgcccatatcaccatggaaacctgtgtgctgggcatggggaatgtgaaggaggtcga
tgcaagtgcttccatggttgggaaggagaccgttgccaatgtccatcctcctctgcccaa
cattgtgtcaattccaagggccaggtgtgcagtgggagagggacttgtgtgtgtgggaag
tgcgaatgcaccgatcctcggatcgttggccgtttctgtgaatattgccccacctgtgat
acagcctgtgatgaaaatcggaattgtgtccaatgccaccatcctcacaatttatctcaa
gctatacttgatcaatgcagaggctcgtgtcctccaagagcccattatattggccaaata
gaagaatgtttctctagcccaagccactttcgaatatttttcatcatcttcatcatcacc
ttccttattggattattgaaggttctcatcatcagacagatcatcctccagaggaccaga
aataaagtgaaatctgccagttacagagtgtccacatcaaagaaggataagatgtttctg
cctgcagtttgcacgcacacggtcacgtatcgccgtgataaacccgacgagataaacatc
gacatcagtaaattgcaccctcatgaaacttttaagtgcaacttctaa

DBGET integrated database retrieval system