KEGG   Sarcophilus harrisii (Tasmanian devil): 100931861Help
Entry
100931861         CDS       T02286                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100931861 (GLS2)
   00330 Arginine and proline metabolism
    100931861 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100931861 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100931861 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    100931861 (GLS2)
   04727 GABAergic synapse
    100931861 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100931861 (GLS2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100931861 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 605 aa AA seqDB search
MRSLRALRGALHGPGGRPPGRGGWGPLARGPLLTRSVRHHLNEAAATQGREMLNSHQPQH
QKEHDSSESGMLSRLGDLLFYTIAEGQERIAIHKFTAALRATGLQTSDPRLRDCMSQMRR
MVRESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTDHVDRIFEETKERTGG
KVAAYIPQLAKSDPDLWGVSLCTVDGQRHSVGQTKIPFCLQSCVKPLTYAISVSNLGTEY
VHKYVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNK
MAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTC
ESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAV
SGAILLVVPNVMGLMCLSPPLDKVGNSHRGISFCQKLVSLFNFHNYDNLRHCAKKLDPRR
EGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHLEVVKF
LVEACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAADALSKEN
LESMV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccctgcgggctctccggggagctctgcacgggccagggggccggccccccggg
cgaggaggatggggtcccctggctcggggccccctcctcactaggagcgttcgtcaccat
ctgaatgaagccgccgcgacccaaggcagggagatgctgaacagccaccagccgcagcat
cagaaggaacatgattcatcagaaagtgggatgctgtcccgcctgggtgacctgctcttc
tacaccattgctgaaggacaagaaaggatcgccatccataagttcactgctgcactgaga
gccactgggctgcagacatcagatccccggcttcgggactgtatgagtcagatgcgtcga
atggttcgagaatccagcagtggaggtctcttagaccgtgatctctttaggaaatgtgtg
agcagcaacattgtgctcctgacccaggcattccgaaagaagtttgttattcctgatttt
gaggagttcacagaccatgtggatcgcatttttgaggagaccaaagaacgcacaggaggc
aaggtggcagcctacattccccaactagccaagtcagatcctgatctatggggtgtctca
ttatgcacagtggatggacaaaggcactcagtaggacagactaagatccccttctgtcta
cagtcctgtgtgaagcccctcacttatgccatatctgtcagcaacctgggcactgagtat
gtgcataaatatgtgggcaaagagcccagtggtctacgttacaacaagctttccctcaat
gaggaaggaatccctcataatccaatggtaaatgctggtgccattgttgtgagttctctg
ataaagatggactgcaataaagcagagaagtttgattttgtgttgcagtatctgaacaaa
atggcaggaaatgaatatatgggtttcagcaatgctacgttccagtcagaaaaagaaact
ggggatcggaattatgcaattggctattatctcaaggaaaagaagtgttttcctaaggga
gttgatatgatggctgcattggacctctactttcagctgtgttcagtggaggtgacatgt
gaatcaggcagtgtcatggcggctacactcgccaatggtggaatctgccccatcacgggc
gagagtgtgctgagtgctgaggctgttcgcaacaccctcagcctcatgcattcctgtggc
atgtatgacttctctggacagtttgcctttcatgtgggccttccagccaaatccgcggtg
tcaggagccatcctgcttgtggtacctaatgtcatggggttgatgtgcctatcacctcca
ttggacaaggtgggaaacagtcataggggcatcagcttctgtcagaagctggtatctctc
ttcaacttccataactatgacaatttgcggcattgtgctaagaagctagatcctcgccgt
gaaggaggagaagtgcggaataagactgtggtgaacctgctttttgctgcctacagtgga
gatgtttcagctcttcgaaggtttgccttgtcagcgatggacatggaacagaaggactat
gattcccgcacagcactacacgtggctgcagcagaaggacacctggaggttgtcaagttc
ctggtggaagcctgcaaagtaaatccttttgtgaaggataggtggggcaatattcccttg
gatgatgctgtgcagtttaaccatctggaggtggtcaaactactgcaggattaccaggac
tcctatactttgtctgagacgcaggctgaggcagcagctgatgccctgtctaaggaaaac
ctggagagcatggtgtaa

DBGET integrated database retrieval system