KEGG   Sarcophilus harrisii (Tasmanian devil): 100931939Help
Entry
100931939         CDS       T02286                                 

Gene name
CHKB
Definition
choline kinase beta
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shr00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 375 aa AA seqDB search
MSMGLKWFKMDRCRSSISLEGKQHAWQWCREFLGGAWRQIQVEQLQVSPVSGGLSNLLFR
CALPENIPLVGDEPREVLLRLYGAILQGVDSLVLESVMFAILAERRLGPRLYGVFPEGRL
EQYIPSRPLGTSELREPRRSAEIAVKMARFHLMEMPFNKEPRWLFGTMERYLKQIQDLIP
PTKTNENLIQRYHLEEEMSMLRKLLDSTSSPVVFCHNDIQEGNILLLSDKEPGLMLIDFE
YSSYNYRGFDIGNHFCEWIYDYSYEESPYFLMEPKNYPNREQQLHFIRNYLSVIQGDDRP
SPEEQTELEENMLVEANRFALASHFFWGLWSILQNIMSTIEFGYLEYAESRFQIYFSQKE
KLNSGLIPPNSPPPP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggggcttaagtggttcaagatggaccggtgcagatcttcgatctccctggag
ggcaagcagcacgcctggcagtggtgccgggagttcctgggcggagcctggcgccaaatc
caggtcgagcagctgcaagtgagccccgtaagcggggggctcagtaacctgcttttccga
tgcgccctcccggagaatataccccttgttggggacgagccccgggaagtgttgctgagg
ctctatggggccattctgcagggggtggactccctagtcctggagagtgtgatgtttgcc
atcctggctgagcgtcggctgggacctcggctttatggggtctttccagaagggaggctg
gagcaatacattccgagccggccgctggggacaagcgagctgagggagccgcggaggtcg
gccgagatcgctgtcaaaatggcccggttccatctgatggagatgcccttcaacaaggag
cctcgctggctcttcgggaccatggagcggtacttgaagcagatccaggacttgattcct
cccactaagaccaacgaaaatctgatccagaggtaccacctggaggaagagatgagcatg
ctacgaaagcttctggattcaacatcctccccagtggtattctgtcacaatgacatccaa
gaagggaacatcctgctgctttctgacaaggagcctggacttatgctcatagattttgag
tacagtagctacaattacaggggttttgacattgggaaccatttctgtgagtggatttat
gactacagctatgaggaatctccctacttcctgatggagcctaaaaactaccccaaccgg
gaacagcagcttcatttcatccgaaattacctgtcagtaatccagggggatgatcgtcct
tccccagaagagcagactgaattggaagagaatatgctggtggaagcaaacaggtttgct
ctggcatcccatttcttctggggactctggtccatcctccaaaatatcatgtctaccatt
gagtttggttacttggaatatgcagaatctcgattccaaatctacttcagtcagaaggag
aagttgaactctggattgatccctcctaacagccctcctcccccctga

DBGET integrated database retrieval system