KEGG   Sarcophilus harrisii (Tasmanian devil): 100931998Help
Entry
100931998         CDS       T02286                                 

Gene name
HAT1
Definition
(RefSeq) histone acetyltransferase 1
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    100931998 (HAT1)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100931998 (HAT1)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100931998 (HAT1)
   HAT complexes
    HATB complex
     100931998 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 397 aa AA seqDB search
MVGSTSLWCVHFRAGSARVDSFSSAASACCTEMAGFGAVEKFLVEYKSAMEKKLAEYKCN
TNEAIQLKLVRFAEDLDNDSTTFNPEYSHQIFGDDETVFGYKGLKIILYYNAGNLSTLFR
IEYASKVSENFDCVEADDVESKIREIIPPGFCTNTDDFISLLEKEVNFKPFGTLLHTYSV
HNKEAGENITYEIYKADMTCTGFREYHERLQTFLMWFIETASFIDVDDERWNYFLVFEKY
NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLFETVHRYYISSP
VVLDITAEDPSENYVKLRDFVLVKLCQDLPCFSPDKLMQGFSQDMVTEAQQKLKINKQHA
RRVYEILRLRVTDMGDAEQSRGYRLDIKRRLIGPYKV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaagtacgtcactgtggtgcgttcacttccgagcagggagcgcgcgggttgat
tcgttctcctcggccgcttcagcctgctgcacggaaatggcgggttttggtgcagtggaa
aaatttttagtggaatacaagagtgctatggaaaagaagctggcagagtacaagtgcaac
accaatgaagcaatccaacttaaattagttcgctttgctgaagatcttgacaatgacagc
acaacttttaatcctgagtacagccatcaaatatttggtgatgatgaaactgtcttcggt
tacaagggtcttaagatcattttgtactataatgctggtaacctgtcaacattgttccga
attgagtatgcatctaaagttagtgagaatttcgactgtgtagaggcagatgatgtggag
agcaaaattagagaaatcattcctccaggattttgtacaaacacagatgattttatttca
ttgttggaaaaggaagttaattttaaaccctttggcacattacttcatacatactcagtt
cacaataaggaagcaggagaaaacattacctatgaaatatacaaggctgacatgacatgt
acaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggtttattgaaact
gctagctttattgacgtggatgatgaaagatggaactactttctagtatttgagaagtat
aataaggatggagctacgctctttgcgaccgtaggctacatgacagtctataattactat
gtgtacccagacaaaacccggccacgtgtaagccagatgttgatattgcctccatttcaa
ggtgaaggccatggtgcccaactttttgaaacagttcatagatattacatttcttctcct
gtagttcttgatattacagctgaagatccatctgaaaactatgtaaaactaagagatttt
gtacttgtgaagctttgccaagatttgccttgcttttcaccagacaagttaatgcaagga
ttcagtcaagatatggtgacagaagcacaacagaaactcaaaataaacaagcaacatgct
aggcgagtttatgaaattctccgattacgtgtgactgacatgggtgatgctgaacaatcc
agaggctatagactggacataaaaagaagattaattggtccatacaaggtataa

DBGET integrated database retrieval system