KEGG   Sarcophilus harrisii (Tasmanian devil): 100932014Help
Entry
100932014         CDS       T02286                                 

Gene name
RXRG
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:shr04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:shr03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:shr04919]
Human Diseases; Cancers; Pathways in cancer [PATH:shr05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:shr05202]
Human Diseases; Cancers; Thyroid cancer [PATH:shr05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:shr05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:shr05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 470 aa AA seqDB search
METDLKQYNQKGIVVIQMRGSLSHTNSTSMSPSPALATGKSPDSHSNYIEAPVSVPRTLA
SPLNAIASPLNALGSSYRVITSAIGPHSLSLATSPGVNMVGPPSSQLNVMNNVRSSDDVK
PLPGIQGMGTMSYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIY
TCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERSENEVESTSSGHED
MPVERILEAELAVEPKTESYGNTNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDL
TLEDQVILLRAGWNELLIASFSHRSVTVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTE
LVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPDQP
GRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggagacagatttgaaacagtataatcagaagggtattgtggtaatccagatgagaggt
tctctcagtcacactaactccacatctatgagcccatcaccagccctggccacaggaaaa
tcaccggacagtcactccaactacattgaggccccagtcagtgttccaaggacacttgcc
tccccactgaatgccatcgcgtctcctctgaatgctctgggctcttcatacagggtcatt
acatcagccataggacctcattcattatccctggctacctctccaggtgtcaacatggtt
ggtccacctagctctcagctcaatgtcatgaacaatgtcagaagctcagatgatgtcaag
cctttgccagggattcaaggaatgggaaccatgagctatccatccactagtccaggctcc
cttgccaaacatatctgtgccatctgtggagacagatcctcaggaaagcactatggggta
tacagttgtgaaggttgtaaaggattcttcaagaggaccataaggaaagacctcatctat
acatgccgggataacaaggactgcctcattgataagcgccaacgtaaccgctgccaatat
tgccgctatcagaagtgccttgtcatgggtatgaagagggaagctgtgcaagaagagagg
cagagaagtcgggagaggtctgagaatgaagtggagtccaccagcagtggccatgaagac
atgcccgtggagaggatcctagaagccgagctcgctgttgaaccaaagactgaatcctat
ggtaacacaaacatggagaattcaacaaatgatcccgtcaccaatatatgccatgctgct
gataagcagctctttactcttgttgaatgggccaaacgcatcccccacttctctgacctc
actttggaagaccaagttattcttcttcgagcaggctggaatgaattgctgattgcctcc
ttctcccatcgctccgtgactgtacaggatggaatcctcctggccactggtttacatgtt
caccgaagcagtgcccatagtgccggtgtggggtccatctttgacagagttctcactgag
ctggtttctaaaatgaaagacatgcagatggataaatccgagttaggctgcctgcgggcc
attgtcctgtttaacccagatgctaagggtttgtccaacccctctgaagtggaagctctc
cgagagaaggtttatgctacccttgaagcatacaccaagcaaaaataccctgatcagcct
ggcaggtttgccaagctcctgcttcgactcccggccctcaggtccatcggcttgaaatgt
cttgagcacctctttttcttcaagctcattggagacacacccattgatacttttctcatg
gagatgctggaaacccctctccagattacctga

DBGET integrated database retrieval system