KEGG   Sarcophilus harrisii (Tasmanian devil): 100932014Help
Entry
100932014         CDS       T02286                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor, gamma
  KO
K08526  
retinoid X receptor gamma
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100932014 (RXRG)
   03320 PPAR signaling pathway
    100932014 (RXRG)
   04919 Thyroid hormone signaling pathway
    100932014 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100932014 (RXRG)
   05202 Transcriptional misregulation in cancers
    100932014 (RXRG)
   05216 Thyroid cancer
    100932014 (RXRG)
   05222 Small cell lung cancer
    100932014 (RXRG)
   05223 Non-small cell lung cancer
    100932014 (RXRG)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100932014 (RXRG)
Nuclear receptors [BR:shr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100932014 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 467 aa AA seqDB search
MYGNYSHFMKFPAGFGSSLSHTNSTSMSPSPALATGKSPDSHSNYIEAPVSVPRTLASPL
NAIASPLNALGSSYRVITSAIGPHSLSLATSPGVNMVGPPSSQLNVMNNVRSSDDVKPLP
GIQGMGTMSYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERSENEVESTSSGHEDMPV
ERILEAELAVEPKTESYGNTNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVTVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVS
KMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattactctcacttcatgaagtttcctgcaggctttggcagttctctcagt
cacactaactccacatctatgagcccatcaccagccctggccacaggaaaatcaccggac
agtcactccaactacattgaggccccagtcagtgttccaaggacacttgcctccccactg
aatgccatcgcgtctcctctgaatgctctgggctcttcatacagggtcattacatcagcc
ataggacctcattcattatccctggctacctctccaggtgtcaacatggttggtccacct
agctctcagctcaatgtcatgaacaatgtcagaagctcagatgatgtcaagcctttgcca
gggattcaaggaatgggaaccatgagctatccatccactagtccaggctcccttgccaaa
catatctgtgccatctgtggagacagatcctcaggaaagcactatggggtatacagttgt
gaaggttgtaaaggattcttcaagaggaccataaggaaagacctcatctatacatgccgg
gataacaaggactgcctcattgataagcgccaacgtaaccgctgccaatattgccgctat
cagaagtgccttgtcatgggtatgaagagggaagctgtgcaagaagagaggcagagaagt
cgggagaggtctgagaatgaagtggagtccaccagcagtggccatgaagacatgcccgtg
gagaggatcctagaagccgagctcgctgttgaaccaaagactgaatcctatggtaacaca
aacatggagaattcaacaaatgatcccgtcaccaatatatgccatgctgctgataagcag
ctctttactcttgttgaatgggccaaacgcatcccccacttctctgacctcactttggaa
gaccaagttattcttcttcgagcaggctggaatgaattgctgattgcctccttctcccat
cgctccgtgactgtacaggatggaatcctcctggccactggtttacatgttcaccgaagc
agtgcccatagtgccggtgtggggtccatctttgacagagttctcactgagctggtttct
aaaatgaaagacatgcagatggataaatccgagttaggctgcctgcgggccattgtcctg
tttaacccagatgctaagggtttgtccaacccctctgaagtggaagctctccgagagaag
gtttatgctacccttgaagcatacaccaagcaaaaataccctgatcagcctggcaggttt
gccaagctcctgcttcgactcccggccctcaggtccatcggcttgaaatgtcttgagcac
ctctttttcttcaagctcattggagacacacccattgatacttttctcatggagatgctg
gaaacccctctccagattacctga

DBGET integrated database retrieval system